SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30036
         (699 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ659247-1|ABG47445.1|  980|Tribolium castaneum chitinase 7 prot...    23   3.2  
AM292371-1|CAL23183.2|  350|Tribolium castaneum gustatory recept...    23   3.2  
AF236856-1|AAG17563.2|  370|Tribolium castaneum Kruppel protein ...    23   3.2  
DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro...    21   7.3  
U81038-1|AAB39355.1|  412|Tribolium castaneum transcription fact...    21   9.7  
AF321227-3|AAK16423.1|  412|Tribolium castaneum Dfd protein.           21   9.7  

>DQ659247-1|ABG47445.1|  980|Tribolium castaneum chitinase 7
           protein.
          Length = 980

 Score = 22.6 bits (46), Expect = 3.2
 Identities = 8/10 (80%), Positives = 9/10 (90%)
 Frame = +2

Query: 305 GWLKNGRLSS 334
           GWLK G+LSS
Sbjct: 124 GWLKKGKLSS 133


>AM292371-1|CAL23183.2|  350|Tribolium castaneum gustatory receptor
           candidate 50 protein.
          Length = 350

 Score = 22.6 bits (46), Expect = 3.2
 Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 1/48 (2%)
 Frame = -3

Query: 145 SFRSNFRSLGTVDKRGADLPLAEHRRSLDIVP-IFASEWVDNLLLNTF 5
           S  S+  SL  + K  A LP+ +H R   +VP ++ + +   L L +F
Sbjct: 2   SLYSSINSLVLISKIFALLPVKKHHRLEKLVPCVYLTSFSVVLSLGSF 49


>AF236856-1|AAG17563.2|  370|Tribolium castaneum Kruppel protein
           protein.
          Length = 370

 Score = 22.6 bits (46), Expect = 3.2
 Identities = 8/25 (32%), Positives = 13/25 (52%)
 Frame = -3

Query: 415 SRSPYW*NQCRRHVERIHRLSSHQC 341
           +  P+  ++CR    R H L  H+C
Sbjct: 243 NEKPFECDKCRGRFRRRHHLVHHKC 267


>DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein.
          Length = 2700

 Score = 21.4 bits (43), Expect = 7.3
 Identities = 12/32 (37%), Positives = 14/32 (43%)
 Frame = +2

Query: 509  TQGGGEQVDFLTPLPRTSRRACHGILPSARCL 604
            T+G G  V +   L   S R C G  P  R L
Sbjct: 956  TKGFGGAVAWTIDLDDFSNRCCGGSFPLLRSL 987


>U81038-1|AAB39355.1|  412|Tribolium castaneum transcription factor
           Deformed protein.
          Length = 412

 Score = 21.0 bits (42), Expect = 9.7
 Identities = 9/33 (27%), Positives = 17/33 (51%)
 Frame = -2

Query: 425 LRWLKESLLVKPMQKTRRTYPSVVFTSMLASMR 327
           ++W K++ L       R+T P+ V T+    +R
Sbjct: 286 MKWKKDNKLPNTKNVRRKTNPAGVTTTTKGKVR 318


>AF321227-3|AAK16423.1|  412|Tribolium castaneum Dfd protein.
          Length = 412

 Score = 21.0 bits (42), Expect = 9.7
 Identities = 9/33 (27%), Positives = 17/33 (51%)
 Frame = -2

Query: 425 LRWLKESLLVKPMQKTRRTYPSVVFTSMLASMR 327
           ++W K++ L       R+T P+ V T+    +R
Sbjct: 286 MKWKKDNKLPNTKNVRRKTNPAGVTTTTKGKVR 318


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 169,127
Number of Sequences: 336
Number of extensions: 3781
Number of successful extensions: 6
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 18426585
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).