SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30031
         (567 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292374-1|CAL23186.2|  659|Tribolium castaneum gustatory recept...    30   0.016
AF225975-1|AAF74117.1|  256|Tribolium castaneum unknown protein.       29   0.037
AF265297-1|AAG17640.1|  125|Tribolium castaneum putative cytochr...    22   3.2  
AY337337-1|AAP94192.1|  505|Tribolium castaneum cytochrome P450 ...    22   4.2  
AF265213-1|AAF75277.1|  143|Tribolium castaneum putative cytochr...    22   4.2  
AF254755-1|AAF70496.1|  505|Tribolium castaneum cytochrome P450 ...    22   4.2  
AF227923-1|AAF36721.1|  351|Tribolium castaneum abdominal-B prot...    22   4.2  
AY043293-1|AAK96033.1|  523|Tribolium castaneum homeodomain tran...    21   5.6  
AF317551-1|AAG39634.1|  312|Tribolium castaneum distal-less prot...    21   5.6  
AF187069-1|AAF03889.1|  471|Tribolium castaneum proboscipedia or...    21   5.6  
AF263515-1|AAF74207.1|  126|Tribolium castaneum cytochrome P450 ...    21   7.3  

>AM292374-1|CAL23186.2|  659|Tribolium castaneum gustatory receptor
           candidate 53 protein.
          Length = 659

 Score = 29.9 bits (64), Expect = 0.016
 Identities = 13/23 (56%), Positives = 15/23 (65%)
 Frame = +1

Query: 484 FKHTAPTKLPSLYNSTTIIKNAF 552
           F H  PTKL S Y ST I++ AF
Sbjct: 62  FMHIVPTKLISFYKSTAILEIAF 84


>AF225975-1|AAF74117.1|  256|Tribolium castaneum unknown protein.
          Length = 256

 Score = 28.7 bits (61), Expect = 0.037
 Identities = 14/44 (31%), Positives = 23/44 (52%)
 Frame = +2

Query: 326 YKIEDPHTGDLKSQHETRDGDVVKGYYSLHEADGSIRVVEYSAE 457
           Y +E  +    + +  T DG +V  Y  +   DGS+R V Y+A+
Sbjct: 195 YVVEGRNYRKYRVEERTSDGFIVGEYGVVSHDDGSLRGVRYTAD 238


>AF265297-1|AAG17640.1|  125|Tribolium castaneum putative cytochrome
           P450 monooxigenase protein.
          Length = 125

 Score = 22.2 bits (45), Expect = 3.2
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = -2

Query: 326 IQMHIWDEHHN 294
           + +HI+D HHN
Sbjct: 86  VHLHIYDMHHN 96


>AY337337-1|AAP94192.1|  505|Tribolium castaneum cytochrome P450
           monooxygenase protein.
          Length = 505

 Score = 21.8 bits (44), Expect = 4.2
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = -2

Query: 326 IQMHIWDEHHN 294
           + +HI+D HHN
Sbjct: 403 VNLHIYDLHHN 413


>AF265213-1|AAF75277.1|  143|Tribolium castaneum putative cytochrome
           P450 monooxigenaseCYP4Q3 protein.
          Length = 143

 Score = 21.8 bits (44), Expect = 4.2
 Identities = 10/29 (34%), Positives = 14/29 (48%), Gaps = 4/29 (13%)
 Frame = -2

Query: 368 VGSSGPQCEGLRF----CIQMHIWDEHHN 294
           +G     C GL+        +HI+D HHN
Sbjct: 86  LGEDFVTCNGLKLPKSTITHLHIYDLHHN 114


>AF254755-1|AAF70496.1|  505|Tribolium castaneum cytochrome P450
           monooxigenase CYP4Q7 protein.
          Length = 505

 Score = 21.8 bits (44), Expect = 4.2
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = -2

Query: 326 IQMHIWDEHHN 294
           + +HI+D HHN
Sbjct: 403 VNLHIYDLHHN 413


>AF227923-1|AAF36721.1|  351|Tribolium castaneum abdominal-B
           protein.
          Length = 351

 Score = 21.8 bits (44), Expect = 4.2
 Identities = 8/17 (47%), Positives = 10/17 (58%)
 Frame = +3

Query: 201 HHGAPTIHAAPVLVHHH 251
           HH    IHA   +V+HH
Sbjct: 324 HHAGHHIHAQHHVVNHH 340


>AY043293-1|AAK96033.1|  523|Tribolium castaneum homeodomain
           transcription factor Maxillopediaprotein.
          Length = 523

 Score = 21.4 bits (43), Expect = 5.6
 Identities = 13/50 (26%), Positives = 21/50 (42%)
 Frame = +2

Query: 266 HHGDQPQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLH 415
           ++ + P  E+Y  H  Y   Y+ E P+       H + DG  V    + H
Sbjct: 361 YNKNHPNSENYINHQNYVQGYQGEHPNYNHY-GYHYSGDGGEVAHLPNTH 409


>AF317551-1|AAG39634.1|  312|Tribolium castaneum distal-less
           protein.
          Length = 312

 Score = 21.4 bits (43), Expect = 5.6
 Identities = 8/20 (40%), Positives = 12/20 (60%)
 Frame = +3

Query: 447 TPPSKHNGFNAVVQAHCSDK 506
           TP  KH+G   +V+   SD+
Sbjct: 214 TPRPKHDGRGRIVERFTSDR 233


>AF187069-1|AAF03889.1|  471|Tribolium castaneum proboscipedia
           ortholog protein.
          Length = 471

 Score = 21.4 bits (43), Expect = 5.6
 Identities = 13/50 (26%), Positives = 21/50 (42%)
 Frame = +2

Query: 266 HHGDQPQYEDYDAHPKYAFEYKIEDPHTGDLKSQHETRDGDVVKGYYSLH 415
           ++ + P  E+Y  H  Y   Y+ E P+       H + DG  V    + H
Sbjct: 309 YNKNHPNSENYINHQNYVQGYQGEHPNYNHY-GYHYSGDGGEVAHLPNTH 357


>AF263515-1|AAF74207.1|  126|Tribolium castaneum cytochrome P450
           monooxygenase protein.
          Length = 126

 Score = 21.0 bits (42), Expect = 7.3
 Identities = 6/11 (54%), Positives = 10/11 (90%)
 Frame = -2

Query: 326 IQMHIWDEHHN 294
           +Q+HI+D H+N
Sbjct: 87  LQLHIYDLHYN 97


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 129,049
Number of Sequences: 336
Number of extensions: 2837
Number of successful extensions: 11
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 11
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11
length of database: 122,585
effective HSP length: 54
effective length of database: 104,441
effective search space used: 13995094
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).