SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30027
         (765 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY887136-1|AAW78361.1|  580|Tribolium castaneum vasa RNA helicas...    44   1e-06
AY800247-1|AAV66724.1|  790|Tribolium castaneum pangolin protein.      25   0.88 
AY800246-1|AAV66723.1|  682|Tribolium castaneum pangolin protein.      25   0.88 
AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ...    25   0.88 
AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ...    25   0.88 
AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ...    25   0.88 
AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ...    25   0.88 
AY316682-1|AAQ83696.1|  456|Tribolium castaneum Sp-like zinc fin...    24   1.2  
DQ855503-1|ABH88190.1|  124|Tribolium castaneum chemosensory pro...    23   2.7  
AY884062-1|AAX84203.1|  712|Tribolium castaneum laccase 2B protein.    23   2.7  
AY884061-1|AAX84202.1|  717|Tribolium castaneum laccase 2A protein.    23   2.7  
DQ855498-1|ABH88185.1|  127|Tribolium castaneum chemosensory pro...    23   3.5  
AM292330-1|CAL23142.2|  408|Tribolium castaneum gustatory recept...    23   3.5  
AJ973445-1|CAJ01492.1|  127|Tribolium castaneum hypothetical pro...    23   3.5  
DQ855502-1|ABH88189.1|  126|Tribolium castaneum chemosensory pro...    21   8.2  
DQ855500-1|ABH88187.1|  126|Tribolium castaneum chemosensory pro...    21   8.2  
DQ855495-1|ABH88182.1|  126|Tribolium castaneum chemosensory pro...    21   8.2  
AM292360-1|CAL23172.2|  427|Tribolium castaneum gustatory recept...    21   8.2  
AM292331-1|CAL23143.2|  437|Tribolium castaneum gustatory recept...    21   8.2  

>AY887136-1|AAW78361.1|  580|Tribolium castaneum vasa RNA helicase
           protein.
          Length = 580

 Score = 44.0 bits (99), Expect = 1e-06
 Identities = 27/94 (28%), Positives = 44/94 (46%), Gaps = 9/94 (9%)
 Frame = +1

Query: 1   GKTATFSISILQQI---------DTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKC 153
           GKTA F + I+  +         + +  +   +I++PTRELA QI         +   K 
Sbjct: 207 GKTAAFMLPIIHNLLSDKNPPNTENNCAQPVVVIMSPTRELAIQIADQGKKFAYNSTVKV 266

Query: 154 HACIGGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
               GGT+      ++  G H++V TPGR+ D +
Sbjct: 267 AVIYGGTSTNHQRGRILGGCHILVATPGRLKDFV 300



 Score = 43.2 bits (97), Expect = 2e-06
 Identities = 23/67 (34%), Positives = 39/67 (58%), Gaps = 4/67 (5%)
 Frame = +3

Query: 276 NTIKLFVLDEADEMLSRGFKDQIHDVFKILS----ADVQVILLSATMPDDVLEVSRCFMR 443
           N++K FVLDEAD ML  GF   + ++    S     + Q ++ SAT P++V +++  F+ 
Sbjct: 308 NSLKYFVLDEADRMLDMGFLGDVEEMLSHQSMPATGERQTLMFSATFPEEVQQLAGKFLL 367

Query: 444 DPVRILV 464
           + + I V
Sbjct: 368 NYIFIAV 374


>AY800247-1|AAV66724.1|  790|Tribolium castaneum pangolin protein.
          Length = 790

 Score = 24.6 bits (51), Expect = 0.88
 Identities = 7/9 (77%), Positives = 7/9 (77%)
 Frame = -3

Query: 226 PPPHEHHSP 200
           PPPH HH P
Sbjct: 737 PPPHPHHQP 745


>AY800246-1|AAV66723.1|  682|Tribolium castaneum pangolin protein.
          Length = 682

 Score = 24.6 bits (51), Expect = 0.88
 Identities = 7/9 (77%), Positives = 7/9 (77%)
 Frame = -3

Query: 226 PPPHEHHSP 200
           PPPH HH P
Sbjct: 629 PPPHPHHQP 637


>AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase
            variant 2 protein.
          Length = 1558

 Score = 24.6 bits (51), Expect = 0.88
 Identities = 12/35 (34%), Positives = 16/35 (45%)
 Frame = +3

Query: 24   IDSTTNRYKHS*MSSFDPGSHKRAGPTNSEGGDSS 128
            ID + +  +   MS+   G H   G    EGGD S
Sbjct: 1155 IDPSGHISRRRSMSASSRGDHHHLGAVTEEGGDES 1189


>AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase
            variant 1 protein.
          Length = 1558

 Score = 24.6 bits (51), Expect = 0.88
 Identities = 12/35 (34%), Positives = 16/35 (45%)
 Frame = +3

Query: 24   IDSTTNRYKHS*MSSFDPGSHKRAGPTNSEGGDSS 128
            ID + +  +   MS+   G H   G    EGGD S
Sbjct: 1155 IDPSGHISRRRSMSASSRGDHHHLGAVTEEGGDES 1189


>AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B
            protein.
          Length = 1558

 Score = 24.6 bits (51), Expect = 0.88
 Identities = 12/35 (34%), Positives = 16/35 (45%)
 Frame = +3

Query: 24   IDSTTNRYKHS*MSSFDPGSHKRAGPTNSEGGDSS 128
            ID + +  +   MS+   G H   G    EGGD S
Sbjct: 1155 IDPSGHISRRRSMSASSRGDHHHLGAVTEEGGDES 1189


>AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A
            protein.
          Length = 1558

 Score = 24.6 bits (51), Expect = 0.88
 Identities = 12/35 (34%), Positives = 16/35 (45%)
 Frame = +3

Query: 24   IDSTTNRYKHS*MSSFDPGSHKRAGPTNSEGGDSS 128
            ID + +  +   MS+   G H   G    EGGD S
Sbjct: 1155 IDPSGHISRRRSMSASSRGDHHHLGAVTEEGGDES 1189


>AY316682-1|AAQ83696.1|  456|Tribolium castaneum Sp-like zinc finger
           protein protein.
          Length = 456

 Score = 24.2 bits (50), Expect = 1.2
 Identities = 13/48 (27%), Positives = 23/48 (47%)
 Frame = -1

Query: 201 QLANIFTDIGATNASMAFSIQVITKSYHHLLNLLGQLSCGSQDQSLTF 58
           Q+AN  TD  +   S+A S  +++   H L +    +  G+Q    +F
Sbjct: 207 QMANYSTDYSSLTHSLAASNHLLSSGQHLLQDTYKSMLPGAQTVGASF 254


>DQ855503-1|ABH88190.1|  124|Tribolium castaneum chemosensory
           protein 17 protein.
          Length = 124

 Score = 23.0 bits (47), Expect = 2.7
 Identities = 7/17 (41%), Positives = 10/17 (58%)
 Frame = +3

Query: 165 WWHQCP*RYSPTGEWCS 215
           WW +   +Y P GE+ S
Sbjct: 96  WWQELQEKYDPKGEYKS 112


>AY884062-1|AAX84203.1|  712|Tribolium castaneum laccase 2B protein.
          Length = 712

 Score = 23.0 bits (47), Expect = 2.7
 Identities = 7/19 (36%), Positives = 11/19 (57%)
 Frame = +3

Query: 75  PGSHKRAGPTNSEGGDSSW 131
           PG+ K+ GP +     +SW
Sbjct: 28  PGAKKKVGPIDQSAAAASW 46


>AY884061-1|AAX84202.1|  717|Tribolium castaneum laccase 2A protein.
          Length = 717

 Score = 23.0 bits (47), Expect = 2.7
 Identities = 7/19 (36%), Positives = 11/19 (57%)
 Frame = +3

Query: 75  PGSHKRAGPTNSEGGDSSW 131
           PG+ K+ GP +     +SW
Sbjct: 28  PGAKKKVGPIDQSAAAASW 46


>DQ855498-1|ABH88185.1|  127|Tribolium castaneum chemosensory
           protein 12 protein.
          Length = 127

 Score = 22.6 bits (46), Expect = 3.5
 Identities = 6/13 (46%), Positives = 9/13 (69%)
 Frame = +3

Query: 165 WWHQCP*RYSPTG 203
           WW++   +Y PTG
Sbjct: 98  WWNELEAKYDPTG 110


>AM292330-1|CAL23142.2|  408|Tribolium castaneum gustatory receptor
           candidate 9 protein.
          Length = 408

 Score = 22.6 bits (46), Expect = 3.5
 Identities = 9/18 (50%), Positives = 10/18 (55%)
 Frame = +1

Query: 109 QKVVIALGDHLNAKCHAC 162
           +K  IAL D  N  CH C
Sbjct: 261 EKSWIALNDDYNRLCHLC 278


>AJ973445-1|CAJ01492.1|  127|Tribolium castaneum hypothetical
           protein protein.
          Length = 127

 Score = 22.6 bits (46), Expect = 3.5
 Identities = 6/13 (46%), Positives = 9/13 (69%)
 Frame = +3

Query: 165 WWHQCP*RYSPTG 203
           WW++   +Y PTG
Sbjct: 98  WWNELEAKYDPTG 110


>DQ855502-1|ABH88189.1|  126|Tribolium castaneum chemosensory
           protein 16 protein.
          Length = 126

 Score = 21.4 bits (43), Expect = 8.2
 Identities = 5/16 (31%), Positives = 10/16 (62%)
 Frame = +3

Query: 162 HWWHQCP*RYSPTGEW 209
           +WW +   ++ P GE+
Sbjct: 96  NWWQELESKFDPQGEY 111


>DQ855500-1|ABH88187.1|  126|Tribolium castaneum chemosensory
           protein 14 protein.
          Length = 126

 Score = 21.4 bits (43), Expect = 8.2
 Identities = 5/16 (31%), Positives = 10/16 (62%)
 Frame = +3

Query: 162 HWWHQCP*RYSPTGEW 209
           +WW +   ++ P GE+
Sbjct: 96  NWWQELEAKFDPKGEY 111


>DQ855495-1|ABH88182.1|  126|Tribolium castaneum chemosensory
           protein 9 protein.
          Length = 126

 Score = 21.4 bits (43), Expect = 8.2
 Identities = 5/16 (31%), Positives = 10/16 (62%)
 Frame = +3

Query: 162 HWWHQCP*RYSPTGEW 209
           +WW +   ++ P GE+
Sbjct: 96  NWWQELESKFDPQGEY 111


>AM292360-1|CAL23172.2|  427|Tribolium castaneum gustatory receptor
           candidate 39 protein.
          Length = 427

 Score = 21.4 bits (43), Expect = 8.2
 Identities = 6/9 (66%), Positives = 9/9 (100%)
 Frame = +3

Query: 636 CVTLLYLLC 662
           C+TLLY++C
Sbjct: 322 CMTLLYIIC 330


>AM292331-1|CAL23143.2|  437|Tribolium castaneum gustatory receptor
           candidate 10 protein.
          Length = 437

 Score = 21.4 bits (43), Expect = 8.2
 Identities = 6/9 (66%), Positives = 9/9 (100%)
 Frame = +3

Query: 636 CVTLLYLLC 662
           C+TLLY++C
Sbjct: 322 CMTLLYIIC 330


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 200,123
Number of Sequences: 336
Number of extensions: 4614
Number of successful extensions: 23
Number of sequences better than 10.0: 19
Number of HSP's better than 10.0 without gapping: 22
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 23
length of database: 122,585
effective HSP length: 56
effective length of database: 103,769
effective search space used: 20546262
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).