SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30024
         (540 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ850295-1|CAH64515.1|  539|Tribolium castaneum putative esteras...    23   1.3  
AJ850293-1|CAH64513.1|  539|Tribolium castaneum putative esteras...    23   1.3  
AJ850292-1|CAH64512.1|  539|Tribolium castaneum putative esteras...    23   1.3  
AJ850297-1|CAH64517.1|  539|Tribolium castaneum putative esteras...    23   1.7  
AF264718-1|AAF75271.1|  125|Tribolium castaneum putative cytochr...    23   2.3  
AJ850294-1|CAH64514.1|  539|Tribolium castaneum putative esteras...    21   5.2  
AY043293-2|AAK96034.1|  353|Tribolium castaneum homeodomain tran...    21   9.2  
AF231104-1|AAF64149.1|  142|Tribolium castaneum labial protein p...    21   9.2  
AF231103-1|AAF64148.1|  142|Tribolium castaneum labial protein p...    21   9.2  

>AJ850295-1|CAH64515.1|  539|Tribolium castaneum putative esterase
           protein.
          Length = 539

 Score = 23.4 bits (48), Expect = 1.3
 Identities = 9/20 (45%), Positives = 12/20 (60%)
 Frame = +3

Query: 207 IWWPSIQQACTQDPTQLKIG 266
           I WP + +  T D T L+IG
Sbjct: 490 IEWPQVPKNATDDLTYLRIG 509


>AJ850293-1|CAH64513.1|  539|Tribolium castaneum putative esterase
           protein.
          Length = 539

 Score = 23.4 bits (48), Expect = 1.3
 Identities = 9/20 (45%), Positives = 12/20 (60%)
 Frame = +3

Query: 207 IWWPSIQQACTQDPTQLKIG 266
           I WP + +  T D T L+IG
Sbjct: 490 IEWPQVPKNATDDLTYLRIG 509


>AJ850292-1|CAH64512.1|  539|Tribolium castaneum putative esterase
           protein.
          Length = 539

 Score = 23.4 bits (48), Expect = 1.3
 Identities = 9/20 (45%), Positives = 12/20 (60%)
 Frame = +3

Query: 207 IWWPSIQQACTQDPTQLKIG 266
           I WP + +  T D T L+IG
Sbjct: 490 IEWPQVPKNATDDLTYLRIG 509


>AJ850297-1|CAH64517.1|  539|Tribolium castaneum putative esterase
           protein.
          Length = 539

 Score = 23.0 bits (47), Expect = 1.7
 Identities = 8/18 (44%), Positives = 11/18 (61%)
 Frame = +3

Query: 213 WPSIQQACTQDPTQLKIG 266
           WP + +  T D T L+IG
Sbjct: 492 WPQVPKNATDDLTYLRIG 509


>AF264718-1|AAF75271.1|  125|Tribolium castaneum putative cytochrome
           P450 monooxigenaseCYP4Q6 protein.
          Length = 125

 Score = 22.6 bits (46), Expect = 2.3
 Identities = 11/36 (30%), Positives = 20/36 (55%)
 Frame = +3

Query: 432 LGNFKLPKHFNDDYFKKNKKCVKRTVNAKRVMTSLP 539
           +G  K+P + +    K  K+C+K T+   R+  S+P
Sbjct: 30  VGKEKIPTYNDLQELKYTKRCIKETL---RLFPSVP 62


>AJ850294-1|CAH64514.1|  539|Tribolium castaneum putative esterase
           protein.
          Length = 539

 Score = 21.4 bits (43), Expect = 5.2
 Identities = 8/20 (40%), Positives = 12/20 (60%)
 Frame = +3

Query: 207 IWWPSIQQACTQDPTQLKIG 266
           I WP + +  T + T L+IG
Sbjct: 490 IEWPQVPKNATDNLTYLRIG 509


>AY043293-2|AAK96034.1|  353|Tribolium castaneum homeodomain
           transcription factor Labialprotein.
          Length = 353

 Score = 20.6 bits (41), Expect = 9.2
 Identities = 10/44 (22%), Positives = 20/44 (45%)
 Frame = -2

Query: 389 TA*RARIESKRSSN*KQTAGQNSNKYNPLACMSTSEENANSSYL 258
           T+  + +ES   ++     G N++    L C++T   N  +  L
Sbjct: 222 TSSSSALESPNPASRSSCLGSNTSSMLSLNCLNTGRTNFTNKQL 265


>AF231104-1|AAF64149.1|  142|Tribolium castaneum labial protein
           protein.
          Length = 142

 Score = 20.6 bits (41), Expect = 9.2
 Identities = 10/44 (22%), Positives = 20/44 (45%)
 Frame = -2

Query: 389 TA*RARIESKRSSN*KQTAGQNSNKYNPLACMSTSEENANSSYL 258
           T+  + +ES   ++     G N++    L C++T   N  +  L
Sbjct: 11  TSSSSALESPNPASRSSCLGSNTSSMLSLNCLNTGRTNFTNKQL 54


>AF231103-1|AAF64148.1|  142|Tribolium castaneum labial protein
           protein.
          Length = 142

 Score = 20.6 bits (41), Expect = 9.2
 Identities = 10/44 (22%), Positives = 20/44 (45%)
 Frame = -2

Query: 389 TA*RARIESKRSSN*KQTAGQNSNKYNPLACMSTSEENANSSYL 258
           T+  + +ES   ++     G N++    L C++T   N  +  L
Sbjct: 11  TSSSSALESPNPASRSSCLGSNTSSMLSLNCLNTGRTNFTNKQL 54


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 127,330
Number of Sequences: 336
Number of extensions: 2746
Number of successful extensions: 9
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9
length of database: 122,585
effective HSP length: 53
effective length of database: 104,777
effective search space used: 13201902
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).