SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30022
         (834 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ855506-1|ABH88193.1|  124|Tribolium castaneum chemosensory pro...    24   1.7  
AY695258-1|AAW21975.1|  232|Tribolium castaneum muscle segment h...    24   1.7  
DQ342040-1|ABC69932.1|  822|Tribolium castaneum STIP protein.          22   6.9  
AM292371-1|CAL23183.2|  350|Tribolium castaneum gustatory recept...    22   6.9  

>DQ855506-1|ABH88193.1|  124|Tribolium castaneum chemosensory
           protein 20 protein.
          Length = 124

 Score = 23.8 bits (49), Expect = 1.7
 Identities = 12/27 (44%), Positives = 16/27 (59%), Gaps = 2/27 (7%)
 Frame = +1

Query: 109 MRAFVV--LACVAMAYGRPEPPVGYSY 183
           MR FV+  +ACV++A  RPE      Y
Sbjct: 1   MRFFVIFFVACVSVALARPEDQYTIKY 27


>AY695258-1|AAW21975.1|  232|Tribolium castaneum muscle segment
           homeodomain protein protein.
          Length = 232

 Score = 23.8 bits (49), Expect = 1.7
 Identities = 10/19 (52%), Positives = 12/19 (63%)
 Frame = +1

Query: 667 PKLQHPLQPFKTGSLLSSN 723
           P+L HP  PF  GSL  S+
Sbjct: 74  PRLGHPQWPFAWGSLXRSS 92


>DQ342040-1|ABC69932.1|  822|Tribolium castaneum STIP protein.
          Length = 822

 Score = 21.8 bits (44), Expect = 6.9
 Identities = 10/30 (33%), Positives = 15/30 (50%)
 Frame = -2

Query: 827 EVRPPKSFRPKSLRPKSTAQSPRPIAPTRF 738
           E +P  SF+ K     S  + PRP   T++
Sbjct: 88  EEKPTTSFKLKDSSSDSEDERPRPGGGTKY 117


>AM292371-1|CAL23183.2|  350|Tribolium castaneum gustatory receptor
           candidate 50 protein.
          Length = 350

 Score = 21.8 bits (44), Expect = 6.9
 Identities = 8/12 (66%), Positives = 10/12 (83%)
 Frame = +1

Query: 37  LIGY*INYHRVS 72
           L+GY INY R+S
Sbjct: 112 LLGYSINYRRIS 123


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 163,828
Number of Sequences: 336
Number of extensions: 3048
Number of successful extensions: 5
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 122,585
effective HSP length: 56
effective length of database: 103,769
effective search space used: 22932949
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).