SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30015
         (660 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292366-1|CAL23178.2|  379|Tribolium castaneum gustatory recept...    30   0.019
AM292329-1|CAL23141.2|  379|Tribolium castaneum gustatory recept...    30   0.019
EF592539-1|ABQ95985.1|  630|Tribolium castaneum beta-N-acetylglu...    22   5.1  
EU019709-1|ABU25221.1|  540|Tribolium castaneum aspartate 1-deca...    21   9.0  
EF592537-1|ABQ95983.1|  593|Tribolium castaneum beta-N-acetylglu...    21   9.0  

>AM292366-1|CAL23178.2|  379|Tribolium castaneum gustatory receptor
           candidate 45 protein.
          Length = 379

 Score = 29.9 bits (64), Expect = 0.019
 Identities = 13/42 (30%), Positives = 22/42 (52%), Gaps = 2/42 (4%)
 Frame = +3

Query: 138 NFFRNKLKLMSFLRKRCNVNPARGPFHFRAP--SKILWKTVE 257
           N+ +  ++ +SF  K CN+     P+ F  P   K LWK ++
Sbjct: 5   NYSKKDIRSLSFFYKICNIFGIVPPYSFEKPDSQKSLWKKIQ 46


>AM292329-1|CAL23141.2|  379|Tribolium castaneum gustatory receptor
           candidate 8 protein.
          Length = 379

 Score = 29.9 bits (64), Expect = 0.019
 Identities = 13/42 (30%), Positives = 22/42 (52%), Gaps = 2/42 (4%)
 Frame = +3

Query: 138 NFFRNKLKLMSFLRKRCNVNPARGPFHFRAP--SKILWKTVE 257
           N+ +  ++ +SF  K CN+     P+ F  P   K LWK ++
Sbjct: 5   NYSKKDIRSLSFFYKICNIFGIVPPYSFEKPDSQKSLWKKIQ 46


>EF592539-1|ABQ95985.1|  630|Tribolium castaneum
           beta-N-acetylglucosaminidase FDL protein.
          Length = 630

 Score = 21.8 bits (44), Expect = 5.1
 Identities = 8/17 (47%), Positives = 11/17 (64%)
 Frame = -2

Query: 524 LSFFSWHSLNSLALPLV 474
           L+ F WH  +S + PLV
Sbjct: 269 LNVFHWHLTDSQSFPLV 285


>EU019709-1|ABU25221.1|  540|Tribolium castaneum aspartate
           1-decarboxylase protein.
          Length = 540

 Score = 21.0 bits (42), Expect = 9.0
 Identities = 7/14 (50%), Positives = 12/14 (85%)
 Frame = -2

Query: 47  QMTTAIDHYGLIAK 6
           Q+ +A+D YGL+A+
Sbjct: 137 QLFSAVDPYGLVAQ 150


>EF592537-1|ABQ95983.1|  593|Tribolium castaneum
           beta-N-acetylglucosaminidase NAG2 protein.
          Length = 593

 Score = 21.0 bits (42), Expect = 9.0
 Identities = 9/27 (33%), Positives = 13/27 (48%)
 Frame = -2

Query: 524 LSFFSWHSLNSLALPLVFKLTNNITVF 444
           L+   WH  +S + PL      N+T F
Sbjct: 246 LNVLHWHITDSQSFPLELPQLPNMTKF 272


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 162,390
Number of Sequences: 336
Number of extensions: 3493
Number of successful extensions: 5
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 17073220
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).