SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30014
         (611 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF633444-1|ABR32189.1|  721|Tribolium castaneum heat shock prote...    25   0.38 
AY675073-1|AAV74190.1|  533|Tribolium castaneum chitinase 5 prot...    23   1.5  
AY769607-1|AAV40983.1|  196|Tribolium castaneum heat shock cogna...    23   2.7  
AY769606-1|AAV40982.1|  196|Tribolium castaneum heat shock prote...    23   2.7  
DQ659254-1|ABG47452.1|  431|Tribolium castaneum imaginal disc gr...    22   3.5  
AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept...    21   6.2  

>EF633444-1|ABR32189.1|  721|Tribolium castaneum heat shock protein
           90 protein.
          Length = 721

 Score = 25.4 bits (53), Expect = 0.38
 Identities = 11/24 (45%), Positives = 17/24 (70%)
 Frame = +1

Query: 283 LSKEEIERMVNEAEKYRNEDDKAK 354
           ++KE +E   +E EK + E+DKAK
Sbjct: 533 VTKEGLELPEDEEEKKKREEDKAK 556


>AY675073-1|AAV74190.1|  533|Tribolium castaneum chitinase 5
           protein.
          Length = 533

 Score = 23.4 bits (48), Expect = 1.5
 Identities = 11/39 (28%), Positives = 19/39 (48%)
 Frame = +2

Query: 131 FELTGIPPAPRGVPQIEVTFDIDANGILNVSAIEKSTNK 247
           +   G+  A   V  I+   D+D NG  N + ++K+  K
Sbjct: 56  YSFIGVNDADWSVLVIDPELDVDQNGFRNFTNLKKTHPK 94


>AY769607-1|AAV40983.1|  196|Tribolium castaneum heat shock cognate
           70 protein.
          Length = 196

 Score = 22.6 bits (46), Expect = 2.7
 Identities = 9/20 (45%), Positives = 12/20 (60%)
 Frame = +2

Query: 476 RTSATSTHSSGWDFQSRLAE 535
           + +A  TH  G DF +RL E
Sbjct: 48  KATAGDTHLGGEDFDNRLVE 67


>AY769606-1|AAV40982.1|  196|Tribolium castaneum heat shock protein
           70 protein.
          Length = 196

 Score = 22.6 bits (46), Expect = 2.7
 Identities = 9/20 (45%), Positives = 12/20 (60%)
 Frame = +2

Query: 476 RTSATSTHSSGWDFQSRLAE 535
           + +A  TH  G DF +RL E
Sbjct: 48  KATAGDTHLGGEDFDNRLVE 67


>DQ659254-1|ABG47452.1|  431|Tribolium castaneum imaginal disc
           growth factor 4 protein.
          Length = 431

 Score = 22.2 bits (45), Expect = 3.5
 Identities = 9/18 (50%), Positives = 11/18 (61%)
 Frame = +3

Query: 492 PPIQVDGISSPGWPSKEE 545
           PP+ +DG    G  SKEE
Sbjct: 308 PPLSIDGALEAGPYSKEE 325


>AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor
           candidate 46 protein.
          Length = 1451

 Score = 21.4 bits (43), Expect = 6.2
 Identities = 11/28 (39%), Positives = 15/28 (53%)
 Frame = -2

Query: 139 QLEFTEQVVIFGHSTLTLKYLDEYSGLV 56
           Q    +QV  F HS  ++ +L E  GLV
Sbjct: 362 QYVMQQQVKNFRHSVRSVFFLSEIFGLV 389


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 150,714
Number of Sequences: 336
Number of extensions: 3255
Number of successful extensions: 6
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 122,585
effective HSP length: 54
effective length of database: 104,441
effective search space used: 15561709
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).