SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30011
         (766 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY884061-1|AAX84202.1|  717|Tribolium castaneum laccase 2A protein.    23   3.5  
AM292382-1|CAL23194.2|  670|Tribolium castaneum gustatory recept...    23   3.5  
EF468474-1|ABR25244.1|  516|Tribolium castaneum methoprene-toler...    22   6.2  
AM292370-1|CAL23182.1|  418|Tribolium castaneum gustatory recept...    22   6.2  
AM292363-1|CAL23175.2|  347|Tribolium castaneum gustatory recept...    22   6.2  
AM292335-1|CAL23147.2|  374|Tribolium castaneum gustatory recept...    22   6.2  
AY884062-1|AAX84203.1|  712|Tribolium castaneum laccase 2B protein.    21   8.2  
AM292366-1|CAL23178.2|  379|Tribolium castaneum gustatory recept...    21   8.2  
AM292329-1|CAL23141.2|  379|Tribolium castaneum gustatory recept...    21   8.2  

>AY884061-1|AAX84202.1|  717|Tribolium castaneum laccase 2A protein.
          Length = 717

 Score = 22.6 bits (46), Expect = 3.5
 Identities = 5/12 (41%), Positives = 11/12 (91%)
 Frame = -3

Query: 299 GFWVFHYNYIYN 264
           GFW+FH +++++
Sbjct: 665 GFWLFHCHFLFH 676


>AM292382-1|CAL23194.2|  670|Tribolium castaneum gustatory receptor
           candidate 61 protein.
          Length = 670

 Score = 22.6 bits (46), Expect = 3.5
 Identities = 9/23 (39%), Positives = 12/23 (52%)
 Frame = -1

Query: 79  QFNLLSLCFCSIKYSVSFLSLIT 11
           QFN +   FC   YS+S   + T
Sbjct: 545 QFNTIVFAFCYCYYSISIRPIST 567


>EF468474-1|ABR25244.1|  516|Tribolium castaneum methoprene-tolerant
           protein.
          Length = 516

 Score = 21.8 bits (44), Expect = 6.2
 Identities = 10/20 (50%), Positives = 13/20 (65%), Gaps = 1/20 (5%)
 Frame = +2

Query: 581 RGFGFVEFDDYDPVDR-VCL 637
           R FGF+E DD   V+  VC+
Sbjct: 329 RTFGFLEIDDQGTVESFVCV 348


>AM292370-1|CAL23182.1|  418|Tribolium castaneum gustatory receptor
           candidate 49 protein.
          Length = 418

 Score = 21.8 bits (44), Expect = 6.2
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = -1

Query: 82  FQFNLLSLCFC 50
           + FNL  LCFC
Sbjct: 317 YTFNLFYLCFC 327


>AM292363-1|CAL23175.2|  347|Tribolium castaneum gustatory receptor
           candidate 42 protein.
          Length = 347

 Score = 21.8 bits (44), Expect = 6.2
 Identities = 9/30 (30%), Positives = 18/30 (60%)
 Frame = +3

Query: 603 LMIMIQLTEYACNKITKLKDSTFGCEKSQY 692
           +MI++  +    N I ++ ++ FG +K QY
Sbjct: 217 IMIILYSSLMVLNYIDEVFNNNFGYDKKQY 246


>AM292335-1|CAL23147.2|  374|Tribolium castaneum gustatory receptor
           candidate 14 protein.
          Length = 374

 Score = 21.8 bits (44), Expect = 6.2
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = -1

Query: 82  FQFNLLSLCFC 50
           + FNL  LCFC
Sbjct: 273 YTFNLFYLCFC 283


>AY884062-1|AAX84203.1|  712|Tribolium castaneum laccase 2B protein.
          Length = 712

 Score = 21.4 bits (43), Expect = 8.2
 Identities = 4/12 (33%), Positives = 11/12 (91%)
 Frame = -3

Query: 299 GFWVFHYNYIYN 264
           G+W+FH +++++
Sbjct: 665 GYWLFHCHFLFH 676


>AM292366-1|CAL23178.2|  379|Tribolium castaneum gustatory receptor
           candidate 45 protein.
          Length = 379

 Score = 21.4 bits (43), Expect = 8.2
 Identities = 9/20 (45%), Positives = 13/20 (65%)
 Frame = +1

Query: 373 LTKLTEELSSQNEQFQGKRL 432
           L  +T  L S+NE+F+ K L
Sbjct: 258 LNFITNNLKSENEEFKEKLL 277


>AM292329-1|CAL23141.2|  379|Tribolium castaneum gustatory receptor
           candidate 8 protein.
          Length = 379

 Score = 21.4 bits (43), Expect = 8.2
 Identities = 9/20 (45%), Positives = 13/20 (65%)
 Frame = +1

Query: 373 LTKLTEELSSQNEQFQGKRL 432
           L  +T  L S+NE+F+ K L
Sbjct: 258 LNFITNNLKSENEEFKEKLL 277


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 169,023
Number of Sequences: 336
Number of extensions: 3465
Number of successful extensions: 11
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 11
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11
length of database: 122,585
effective HSP length: 56
effective length of database: 103,769
effective search space used: 20546262
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).