SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30009
         (801 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept...    26   0.40 
AM292324-1|CAL23136.1|  398|Tribolium castaneum gustatory recept...    26   0.40 
AJ850289-1|CAH64509.1|  533|Tribolium castaneum putative esteras...    25   0.93 
X91618-1|CAA62821.1|  524|Tribolium castaneum hunchback protein.       23   3.7  
L01615-1|AAA30095.1|   69|Tribolium castaneum zinc finger protei...    23   3.7  
EF592536-1|ABQ95982.1|  598|Tribolium castaneum beta-N-acetylglu...    22   5.0  
AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ...    21   8.7  
AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ...    21   8.7  

>AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor
           candidate 46 protein.
          Length = 1451

 Score = 25.8 bits (54), Expect = 0.40
 Identities = 13/45 (28%), Positives = 25/45 (55%)
 Frame = -1

Query: 582 IDEYNAISESK*LSLRRIFVIQFKMCN*HSSLSKNT*AISLFTDI 448
           +++Y  +     +S RR+F+   K+C  H  LSK   ++ LF ++
Sbjct: 202 LNQYLRLKPEGRISNRRVFISFSKICYLHQHLSK---SVKLFNEV 243


>AM292324-1|CAL23136.1|  398|Tribolium castaneum gustatory receptor
           candidate 3 protein.
          Length = 398

 Score = 25.8 bits (54), Expect = 0.40
 Identities = 13/45 (28%), Positives = 25/45 (55%)
 Frame = -1

Query: 582 IDEYNAISESK*LSLRRIFVIQFKMCN*HSSLSKNT*AISLFTDI 448
           +++Y  +     +S RR+F+   K+C  H  LSK   ++ LF ++
Sbjct: 220 LNQYLRLKPEGRISNRRVFISFSKICYLHQHLSK---SVKLFNEV 261


>AJ850289-1|CAH64509.1|  533|Tribolium castaneum putative esterase
           protein.
          Length = 533

 Score = 24.6 bits (51), Expect = 0.93
 Identities = 11/20 (55%), Positives = 13/20 (65%)
 Frame = +2

Query: 722 KGCNILDAKLVWLLIIGGGF 781
           +GCN L   +VW  I GGGF
Sbjct: 95  EGCNFLKPVMVW--IHGGGF 112


>X91618-1|CAA62821.1|  524|Tribolium castaneum hunchback protein.
          Length = 524

 Score = 22.6 bits (46), Expect = 3.7
 Identities = 8/19 (42%), Positives = 12/19 (63%)
 Frame = -1

Query: 219 KSQYNSHQVSYQ*IFLFSC 163
           KS  NSH  S+  ++ +SC
Sbjct: 271 KSMLNSHMKSHSNVYRYSC 289


>L01615-1|AAA30095.1|   69|Tribolium castaneum zinc finger protein
           protein.
          Length = 69

 Score = 22.6 bits (46), Expect = 3.7
 Identities = 8/19 (42%), Positives = 12/19 (63%)
 Frame = -1

Query: 219 KSQYNSHQVSYQ*IFLFSC 163
           KS  NSH  S+  ++ +SC
Sbjct: 29  KSMLNSHMKSHSNVYRYSC 47


>EF592536-1|ABQ95982.1|  598|Tribolium castaneum
           beta-N-acetylglucosaminidase NAG1 protein.
          Length = 598

 Score = 22.2 bits (45), Expect = 5.0
 Identities = 10/36 (27%), Positives = 18/36 (50%)
 Frame = -2

Query: 260 IDINNKYINNLRFKKVNIIHTK*VISESFYFPANSI 153
           +D+  + ++ +   K+N  H     S SF F A S+
Sbjct: 224 VDVIKRTLDGMAASKLNSFHWHITDSHSFPFTAESL 259


>AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase
            protein.
          Length = 1464

 Score = 21.4 bits (43), Expect = 8.7
 Identities = 7/18 (38%), Positives = 14/18 (77%)
 Frame = +1

Query: 667  NCLRFIYWHYVTIFTLFL 720
            NCL++   +YVT+ +++L
Sbjct: 1000 NCLKYGVIYYVTVPSMYL 1017


>AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2
            protein.
          Length = 1464

 Score = 21.4 bits (43), Expect = 8.7
 Identities = 7/18 (38%), Positives = 14/18 (77%)
 Frame = +1

Query: 667  NCLRFIYWHYVTIFTLFL 720
            NCL++   +YVT+ +++L
Sbjct: 1000 NCLKYGVIYYVTVPSMYL 1017


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 190,495
Number of Sequences: 336
Number of extensions: 4140
Number of successful extensions: 13
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 13
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 13
length of database: 122,585
effective HSP length: 56
effective length of database: 103,769
effective search space used: 21791490
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).