SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30008
         (465 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ855498-1|ABH88185.1|  127|Tribolium castaneum chemosensory pro...    23   1.8  
DQ855497-1|ABH88184.1|  127|Tribolium castaneum chemosensory pro...    23   1.8  
AJ973445-1|CAJ01492.1|  127|Tribolium castaneum hypothetical pro...    23   1.8  
DQ855496-1|ABH88183.1|  129|Tribolium castaneum chemosensory pro...    22   2.4  
AM292352-1|CAL23164.1|  250|Tribolium castaneum gustatory recept...    22   2.4  
AJ005083-1|CAB65469.1|  585|Tribolium castaneum signal receptor ...    22   2.4  
U81040-1|AAB39356.1|  283|Tribolium castaneum TC Deformed protein.     21   4.3  
U81038-1|AAB39355.1|  412|Tribolium castaneum transcription fact...    21   4.3  
EU019711-1|ABU25223.1|  534|Tribolium castaneum chitin deacetyla...    21   4.3  
AF321227-3|AAK16423.1|  412|Tribolium castaneum Dfd protein.           21   4.3  
DQ855505-1|ABH88192.1|  119|Tribolium castaneum chemosensory pro...    21   5.6  
AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr...    21   5.6  
AF227923-1|AAF36721.1|  351|Tribolium castaneum abdominal-B prot...    21   5.6  
DQ855490-1|ABH88177.1|  133|Tribolium castaneum chemosensory pro...    21   7.4  
DQ414247-1|ABD63009.2|  414|Tribolium castaneum paired protein.        21   7.4  
AM292334-1|CAL23146.2|  390|Tribolium castaneum gustatory recept...    21   7.4  
AM292333-1|CAL23145.2|  316|Tribolium castaneum gustatory recept...    21   7.4  
DQ659252-1|ABG47450.1|  377|Tribolium castaneum chitinase 13 pro...    20   9.8  
AY453651-1|AAR89057.1|  199|Tribolium castaneum serrate protein.       20   9.8  
AM292374-1|CAL23186.2|  659|Tribolium castaneum gustatory recept...    20   9.8  

>DQ855498-1|ABH88185.1|  127|Tribolium castaneum chemosensory
           protein 12 protein.
          Length = 127

 Score = 22.6 bits (46), Expect = 1.8
 Identities = 7/24 (29%), Positives = 16/24 (66%)
 Frame = -1

Query: 294 TTRYENVHLMMSIRAETTIKTELN 223
           TT+Y+N+ L   ++++  +K  +N
Sbjct: 23  TTKYDNIDLNQILKSDRLLKNYVN 46


>DQ855497-1|ABH88184.1|  127|Tribolium castaneum chemosensory
           protein 11 protein.
          Length = 127

 Score = 22.6 bits (46), Expect = 1.8
 Identities = 9/24 (37%), Positives = 16/24 (66%)
 Frame = -1

Query: 294 TTRYENVHLMMSIRAETTIKTELN 223
           TT+Y+NV L   I+++  +K  +N
Sbjct: 25  TTKYDNVDLDEIIKSDRLLKNYVN 48


>AJ973445-1|CAJ01492.1|  127|Tribolium castaneum hypothetical
           protein protein.
          Length = 127

 Score = 22.6 bits (46), Expect = 1.8
 Identities = 7/24 (29%), Positives = 16/24 (66%)
 Frame = -1

Query: 294 TTRYENVHLMMSIRAETTIKTELN 223
           TT+Y+N+ L   ++++  +K  +N
Sbjct: 23  TTKYDNIDLNQILKSDRLLKNYVN 46


>DQ855496-1|ABH88183.1|  129|Tribolium castaneum chemosensory
           protein 10 protein.
          Length = 129

 Score = 22.2 bits (45), Expect = 2.4
 Identities = 10/38 (26%), Positives = 19/38 (50%)
 Frame = -1

Query: 294 TTRYENVHLMMSIRAETTIKTELNAAVRLPLSLRDLEE 181
           TT+Y+N+ L   ++++  +K   N  +       D EE
Sbjct: 25  TTKYDNIDLEEILKSDRLLKNYFNCLMERGTCSPDGEE 62


>AM292352-1|CAL23164.1|  250|Tribolium castaneum gustatory receptor
           candidate 31 protein.
          Length = 250

 Score = 22.2 bits (45), Expect = 2.4
 Identities = 8/21 (38%), Positives = 14/21 (66%)
 Frame = +2

Query: 263 IIRCTFSYLVVLDVNTSLYFI 325
           +I    SY++++   T+LYFI
Sbjct: 157 LIDNNMSYIIIVSFATNLYFI 177


>AJ005083-1|CAB65469.1|  585|Tribolium castaneum signal receptor
           protein protein.
          Length = 585

 Score = 22.2 bits (45), Expect = 2.4
 Identities = 6/15 (40%), Positives = 10/15 (66%)
 Frame = +1

Query: 391 CVRGGACVDDVLIYM 435
           C+ GG C+D +  Y+
Sbjct: 32  CMNGGTCIDGINSYI 46


>U81040-1|AAB39356.1|  283|Tribolium castaneum TC Deformed protein.
          Length = 283

 Score = 21.4 bits (43), Expect = 4.3
 Identities = 7/13 (53%), Positives = 9/13 (69%)
 Frame = -1

Query: 51  TEPRCTVLRTRPP 13
           T+P C  L T+PP
Sbjct: 109 TQPMCESLNTQPP 121


>U81038-1|AAB39355.1|  412|Tribolium castaneum transcription factor
           Deformed protein.
          Length = 412

 Score = 21.4 bits (43), Expect = 4.3
 Identities = 7/13 (53%), Positives = 9/13 (69%)
 Frame = -1

Query: 51  TEPRCTVLRTRPP 13
           T+P C  L T+PP
Sbjct: 109 TQPMCESLNTQPP 121


>EU019711-1|ABU25223.1|  534|Tribolium castaneum chitin deacetylase
           1 protein.
          Length = 534

 Score = 21.4 bits (43), Expect = 4.3
 Identities = 9/21 (42%), Positives = 12/21 (57%)
 Frame = +2

Query: 260 DIIRCTFSYLVVLDVNTSLYF 322
           D+I+CT S L  +     LYF
Sbjct: 61  DVIQCTSSGLQAIRCPAGLYF 81


>AF321227-3|AAK16423.1|  412|Tribolium castaneum Dfd protein.
          Length = 412

 Score = 21.4 bits (43), Expect = 4.3
 Identities = 7/13 (53%), Positives = 9/13 (69%)
 Frame = -1

Query: 51  TEPRCTVLRTRPP 13
           T+P C  L T+PP
Sbjct: 109 TQPMCESLNTQPP 121


>DQ855505-1|ABH88192.1|  119|Tribolium castaneum chemosensory
           protein 19 protein.
          Length = 119

 Score = 21.0 bits (42), Expect = 5.6
 Identities = 9/38 (23%), Positives = 19/38 (50%)
 Frame = -1

Query: 294 TTRYENVHLMMSIRAETTIKTELNAAVRLPLSLRDLEE 181
           TT+Y+N+++   + +E  +K   N  +       D +E
Sbjct: 20  TTKYDNINVDEILASERLLKNYFNCIMDRGACTPDADE 57


>AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like
           protein protein.
          Length = 1156

 Score = 21.0 bits (42), Expect = 5.6
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = -3

Query: 46  APMHSPP 26
           APMHSPP
Sbjct: 195 APMHSPP 201


>AF227923-1|AAF36721.1|  351|Tribolium castaneum abdominal-B
           protein.
          Length = 351

 Score = 21.0 bits (42), Expect = 5.6
 Identities = 9/21 (42%), Positives = 11/21 (52%)
 Frame = -3

Query: 76  APRKSASTDRAPMHSPPNAAA 14
           +P   AS   AP+H P   AA
Sbjct: 43  SPASVASNASAPLHIPAKRAA 63


>DQ855490-1|ABH88177.1|  133|Tribolium castaneum chemosensory
           protein 4 protein.
          Length = 133

 Score = 20.6 bits (41), Expect = 7.4
 Identities = 7/21 (33%), Positives = 14/21 (66%)
 Frame = -1

Query: 294 TTRYENVHLMMSIRAETTIKT 232
           TT+Y+N+ L   ++ E  +K+
Sbjct: 27  TTKYDNIDLENVVKNERLLKS 47


>DQ414247-1|ABD63009.2|  414|Tribolium castaneum paired protein.
          Length = 414

 Score = 20.6 bits (41), Expect = 7.4
 Identities = 13/40 (32%), Positives = 16/40 (40%)
 Frame = -1

Query: 150 FLDKDLEVLVNDGDGEQYPSARSRWPRGSRPALTEPRCTV 31
           F    L+ L    +  QYP   +R     R  LTE R  V
Sbjct: 227 FTAHQLDELEKAFERTQYPDIYTREELAQRTKLTEARIQV 266


>AM292334-1|CAL23146.2|  390|Tribolium castaneum gustatory receptor
           candidate 13 protein.
          Length = 390

 Score = 20.6 bits (41), Expect = 7.4
 Identities = 7/16 (43%), Positives = 11/16 (68%)
 Frame = +1

Query: 97  ILLAVTIIYQYFEIFV 144
           ILL + + Y YF++ V
Sbjct: 213 ILLMIQLYYLYFDVIV 228


>AM292333-1|CAL23145.2|  316|Tribolium castaneum gustatory receptor
           candidate 12 protein.
          Length = 316

 Score = 20.6 bits (41), Expect = 7.4
 Identities = 7/16 (43%), Positives = 11/16 (68%)
 Frame = +1

Query: 97  ILLAVTIIYQYFEIFV 144
           ILL + + Y YF++ V
Sbjct: 139 ILLMIQLYYLYFDVIV 154


>DQ659252-1|ABG47450.1|  377|Tribolium castaneum chitinase 13
           protein.
          Length = 377

 Score = 20.2 bits (40), Expect = 9.8
 Identities = 8/25 (32%), Positives = 13/25 (52%)
 Frame = -1

Query: 177 CAHAAHLRLFLDKDLEVLVNDGDGE 103
           C H  +  + LDKD  + V D + +
Sbjct: 52  CTHINYAFVGLDKDCNIQVLDEEND 76


>AY453651-1|AAR89057.1|  199|Tribolium castaneum serrate protein.
          Length = 199

 Score = 20.2 bits (40), Expect = 9.8
 Identities = 6/11 (54%), Positives = 7/11 (63%)
 Frame = +1

Query: 391 CVRGGACVDDV 423
           C  GG CVD +
Sbjct: 77  CENGGTCVDKI 87


>AM292374-1|CAL23186.2|  659|Tribolium castaneum gustatory receptor
           candidate 53 protein.
          Length = 659

 Score = 20.2 bits (40), Expect = 9.8
 Identities = 7/17 (41%), Positives = 11/17 (64%)
 Frame = +2

Query: 287 LVVLDVNTSLYFIEKIR 337
           L+  D+NT  + + KIR
Sbjct: 26  LITFDINTPSFKLSKIR 42


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 110,284
Number of Sequences: 336
Number of extensions: 2169
Number of successful extensions: 20
Number of sequences better than 10.0: 20
Number of HSP's better than 10.0 without gapping: 20
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 20
length of database: 122,585
effective HSP length: 52
effective length of database: 105,113
effective search space used: 10721526
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).