SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30007
         (796 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF225975-1|AAF74117.1|  256|Tribolium castaneum unknown protein.       26   0.40 
DQ659251-1|ABG47449.1|  366|Tribolium castaneum chitinase 11 pro...    21   8.6  

>AF225975-1|AAF74117.1|  256|Tribolium castaneum unknown protein.
          Length = 256

 Score = 25.8 bits (54), Expect = 0.40
 Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 1/21 (4%)
 Frame = +2

Query: 521 GEYTLVEAD-GSVRKVEYTAD 580
           GEY +V  D GS+R V YTAD
Sbjct: 218 GEYGVVSHDDGSLRGVRYTAD 238


>DQ659251-1|ABG47449.1|  366|Tribolium castaneum chitinase 11
           protein.
          Length = 366

 Score = 21.4 bits (43), Expect = 8.6
 Identities = 13/51 (25%), Positives = 22/51 (43%)
 Frame = +3

Query: 369 KVIAPAHKVLVSAHHEEEYAHPKYDFAYSVADGHSGDNKSQHESRDGTLCT 521
           K+   A  +L+S H  E        F  S A   +G+   + ++ +  LCT
Sbjct: 4   KLCLLASALLISTHQTEAKTDKILCFFASWAGYRNGEGSFKPQNINANLCT 54


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 121,202
Number of Sequences: 336
Number of extensions: 1820
Number of successful extensions: 3
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 122,585
effective HSP length: 56
effective length of database: 103,769
effective search space used: 21583952
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).