SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30006
         (796 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292340-1|CAL23152.1|  355|Tribolium castaneum gustatory recept...    27   0.17 
AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept...    24   1.2  
AY043293-1|AAK96033.1|  523|Tribolium castaneum homeodomain tran...    22   4.9  
AF187069-1|AAF03889.1|  471|Tribolium castaneum proboscipedia or...    22   4.9  
AF187068-1|AAF03888.1|  477|Tribolium castaneum proboscipedia or...    22   4.9  
AM292383-1|CAL23195.2|  320|Tribolium castaneum gustatory recept...    21   8.6  
AM292358-1|CAL23170.2|  331|Tribolium castaneum gustatory recept...    21   8.6  
AM292353-1|CAL23165.2|  651|Tribolium castaneum gustatory recept...    21   8.6  

>AM292340-1|CAL23152.1|  355|Tribolium castaneum gustatory receptor
           candidate 19 protein.
          Length = 355

 Score = 27.1 bits (57), Expect = 0.17
 Identities = 9/23 (39%), Positives = 16/23 (69%)
 Frame = +1

Query: 505 TVHF*LNKFVFIYYTVIIVCIFF 573
           TVHF L  + F Y  +I++C+++
Sbjct: 93  TVHFLLCTYYFYYAFIILLCVYY 115


>AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor
           candidate 46 protein.
          Length = 1451

 Score = 24.2 bits (50), Expect = 1.2
 Identities = 15/42 (35%), Positives = 21/42 (50%), Gaps = 2/42 (4%)
 Frame = -3

Query: 584 TREQKKIHTIMTV**IKTNLFN*KCTV--VYHYKNLRLNMHY 465
           T++Q KIH I+    + T L    CTV  V  + N +   HY
Sbjct: 484 TKQQSKIHLIVRSVFVTTYLMFDYCTVLRVQRFNNYQSLAHY 525


>AY043293-1|AAK96033.1|  523|Tribolium castaneum homeodomain
           transcription factor Maxillopediaprotein.
          Length = 523

 Score = 22.2 bits (45), Expect = 4.9
 Identities = 11/25 (44%), Positives = 16/25 (64%), Gaps = 3/25 (12%)
 Frame = -1

Query: 739 EDSPNI---PGSRTSLPSGNSTIGM 674
           +D+ N+   P S +SLP GN+  GM
Sbjct: 215 QDAANVKLSPKSASSLPPGNNIHGM 239


>AF187069-1|AAF03889.1|  471|Tribolium castaneum proboscipedia
           ortholog protein.
          Length = 471

 Score = 22.2 bits (45), Expect = 4.9
 Identities = 11/25 (44%), Positives = 16/25 (64%), Gaps = 3/25 (12%)
 Frame = -1

Query: 739 EDSPNI---PGSRTSLPSGNSTIGM 674
           +D+ N+   P S +SLP GN+  GM
Sbjct: 163 QDAANVKLSPKSASSLPPGNNIHGM 187


>AF187068-1|AAF03888.1|  477|Tribolium castaneum proboscipedia
           ortholog protein.
          Length = 477

 Score = 22.2 bits (45), Expect = 4.9
 Identities = 11/25 (44%), Positives = 16/25 (64%), Gaps = 3/25 (12%)
 Frame = -1

Query: 739 EDSPNI---PGSRTSLPSGNSTIGM 674
           +D+ N+   P S +SLP GN+  GM
Sbjct: 346 QDAANVKLSPKSASSLPPGNNIHGM 370


>AM292383-1|CAL23195.2|  320|Tribolium castaneum gustatory receptor
           candidate 62 protein.
          Length = 320

 Score = 21.4 bits (43), Expect = 8.6
 Identities = 11/24 (45%), Positives = 16/24 (66%), Gaps = 2/24 (8%)
 Frame = +3

Query: 519 VKQIRF-YL-LYSHYSVYFFLFTS 584
           VK+  F Y+ LYS + +YF LF +
Sbjct: 130 VKEYAFEYIQLYSQFILYFLLFAT 153


>AM292358-1|CAL23170.2|  331|Tribolium castaneum gustatory receptor
           candidate 37 protein.
          Length = 331

 Score = 21.4 bits (43), Expect = 8.6
 Identities = 11/24 (45%), Positives = 16/24 (66%), Gaps = 2/24 (8%)
 Frame = +3

Query: 519 VKQIRF-YL-LYSHYSVYFFLFTS 584
           VK+  F Y+ LYS + +YF LF +
Sbjct: 130 VKEYAFEYIQLYSQFILYFLLFAT 153


>AM292353-1|CAL23165.2|  651|Tribolium castaneum gustatory receptor
           candidate 32 protein.
          Length = 651

 Score = 21.4 bits (43), Expect = 8.6
 Identities = 11/24 (45%), Positives = 16/24 (66%), Gaps = 2/24 (8%)
 Frame = +3

Query: 519 VKQIRF-YL-LYSHYSVYFFLFTS 584
           VK+  F Y+ LYS + +YF LF +
Sbjct: 450 VKEYAFEYIQLYSQFILYFLLFAT 473


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 161,948
Number of Sequences: 336
Number of extensions: 3596
Number of successful extensions: 10
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 10
length of database: 122,585
effective HSP length: 56
effective length of database: 103,769
effective search space used: 21583952
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).