SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30001
         (833 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292340-1|CAL23152.1|  355|Tribolium castaneum gustatory recept...    25   0.56 
Z69735-1|CAA93623.1|  162|Tribolium castaneum initiation factor ...    22   5.2  
AM292364-1|CAL23176.2|  353|Tribolium castaneum gustatory recept...    22   6.9  
AM292362-1|CAL23174.2|  398|Tribolium castaneum gustatory recept...    22   6.9  
DQ342040-1|ABC69932.1|  822|Tribolium castaneum STIP protein.          21   9.1  

>AM292340-1|CAL23152.1|  355|Tribolium castaneum gustatory receptor
           candidate 19 protein.
          Length = 355

 Score = 25.4 bits (53), Expect = 0.56
 Identities = 10/31 (32%), Positives = 18/31 (58%)
 Frame = +2

Query: 635 LYMYYLCIRPGLYQ*FYLVYLFVLSRVHILL 727
           +++ + C+   L   +Y  Y F+L  VH+LL
Sbjct: 224 IHLLFYCVLIILLCIYYFYYAFILFTVHLLL 254



 Score = 21.4 bits (43), Expect = 9.1
 Identities = 11/29 (37%), Positives = 15/29 (51%)
 Frame = +2

Query: 638 YMYYLCIRPGLYQ*FYLVYLFVLSRVHIL 724
           Y YY  I   L   +Y  Y F++  VH+L
Sbjct: 102 YFYYAFII--LLCVYYFYYAFIIFTVHLL 128


>Z69735-1|CAA93623.1|  162|Tribolium castaneum initiation factor
           5-like protein protein.
          Length = 162

 Score = 22.2 bits (45), Expect = 5.2
 Identities = 7/20 (35%), Positives = 13/20 (65%)
 Frame = -3

Query: 531 NAGSGDNTRGIEWSENILED 472
           N+ +GD+  G EW  ++ E+
Sbjct: 108 NSKNGDDDEGHEWQADVSEE 127


>AM292364-1|CAL23176.2|  353|Tribolium castaneum gustatory receptor
           candidate 43 protein.
          Length = 353

 Score = 21.8 bits (44), Expect = 6.9
 Identities = 11/44 (25%), Positives = 19/44 (43%)
 Frame = +2

Query: 32  HLFTNTCSRFVSVLVTLQVSHPKRRTLLTMESNRVSLIRRVMTL 163
           H F       ++ ++ ++     R  L  M  N + L+RR  TL
Sbjct: 160 HFFYQLLLYLITDMILMRYKELNRVILDNMSRNHLFLVRRTETL 203


>AM292362-1|CAL23174.2|  398|Tribolium castaneum gustatory receptor
           candidate 41 protein.
          Length = 398

 Score = 21.8 bits (44), Expect = 6.9
 Identities = 14/52 (26%), Positives = 24/52 (46%), Gaps = 2/52 (3%)
 Frame = -3

Query: 156 MTRRIKLTLFDSIVKSVLLFGCETWRVTKTLTNRLQVFVNKC--LRSILRIF 7
           M  ++ +  F   +K + +FG    +   + +N +Q   N C  L S L IF
Sbjct: 283 MVTKLVVVTFLKFIKKIQIFGIMITKACMSASNLIQRTPNICYKLLSNLGIF 334


>DQ342040-1|ABC69932.1|  822|Tribolium castaneum STIP protein.
          Length = 822

 Score = 21.4 bits (43), Expect = 9.1
 Identities = 9/32 (28%), Positives = 15/32 (46%)
 Frame = -3

Query: 240 GSDEDIEIRIRKARGAFAQLKPVWESSVMTRR 145
           G    +E  +RK RGA     P   +S+  ++
Sbjct: 184 GISAPVEAHLRKGRGAIGAYGPEKSASIPKKK 215


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 209,410
Number of Sequences: 336
Number of extensions: 4691
Number of successful extensions: 13
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 11
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 13
length of database: 122,585
effective HSP length: 56
effective length of database: 103,769
effective search space used: 22932949
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).