SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0036
         (648 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF125543-1|ABL73927.1|  475|Tribolium castaneum chitinase 4 prot...    23   2.2  
DQ659247-1|ABG47445.1|  980|Tribolium castaneum chitinase 7 prot...    22   3.8  
AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept...    22   3.8  
AM292322-1|CAL23134.1|  373|Tribolium castaneum gustatory recept...    22   3.8  
AY293621-1|AAP46162.1|  392|Tribolium castaneum glass protein pr...    21   8.7  

>EF125543-1|ABL73927.1|  475|Tribolium castaneum chitinase 4
           protein.
          Length = 475

 Score = 23.0 bits (47), Expect = 2.2
 Identities = 13/40 (32%), Positives = 18/40 (45%)
 Frame = -2

Query: 200 VRDYFPELCSDLIPALTRLDVDDFPHDCTKNLEPPESNIK 81
           V D  P LC+ LI +   L  D        NL+  + N+K
Sbjct: 41  VEDIDPTLCTHLIYSFVGLGDDSRIKHLEPNLDVNQGNLK 80


>DQ659247-1|ABG47445.1|  980|Tribolium castaneum chitinase 7
           protein.
          Length = 980

 Score = 22.2 bits (45), Expect = 3.8
 Identities = 8/18 (44%), Positives = 14/18 (77%), Gaps = 2/18 (11%)
 Frame = -3

Query: 493 CFFSNYIQYR--INQFSP 446
           C+++N+ QYR  I +F+P
Sbjct: 91  CYYTNWSQYRVKIGKFTP 108


>AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor
            candidate 46 protein.
          Length = 1451

 Score = 22.2 bits (45), Expect = 3.8
 Identities = 7/11 (63%), Positives = 10/11 (90%)
 Frame = +2

Query: 44   FFFYMIKFSKV 76
            +FFY++KF KV
Sbjct: 1028 YFFYLVKFYKV 1038


>AM292322-1|CAL23134.1|  373|Tribolium castaneum gustatory receptor
           candidate 1 protein.
          Length = 373

 Score = 22.2 bits (45), Expect = 3.8
 Identities = 7/11 (63%), Positives = 10/11 (90%)
 Frame = +2

Query: 44  FFFYMIKFSKV 76
           +FFY++KF KV
Sbjct: 309 YFFYLVKFYKV 319


>AY293621-1|AAP46162.1|  392|Tribolium castaneum glass protein
           protein.
          Length = 392

 Score = 21.0 bits (42), Expect = 8.7
 Identities = 6/19 (31%), Positives = 12/19 (63%)
 Frame = -2

Query: 452 QPPLCNVLSPSYSPPQTVR 396
           +P +C +   SY+ P T++
Sbjct: 248 KPNVCRICGKSYARPSTLK 266


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 163,015
Number of Sequences: 336
Number of extensions: 3731
Number of successful extensions: 15
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 15
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 15
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 16656800
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).