SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0034
         (598 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292376-1|CAL23188.2|  402|Tribolium castaneum gustatory recept...    22   3.4  
AM292332-1|CAL23144.2|  344|Tribolium castaneum gustatory recept...    22   3.4  
DQ855506-1|ABH88193.1|  124|Tribolium castaneum chemosensory pro...    22   4.5  
AF017415-2|AAB70263.1|  284|Tribolium castaneum abdominal-A prot...    22   4.5  
AF017415-1|AAB70262.1|  343|Tribolium castaneum abdominal-AII pr...    22   4.5  
AJ415419-1|CAC94468.1|  441|Tribolium castaneum transcription fa...    21   6.0  

>AM292376-1|CAL23188.2|  402|Tribolium castaneum gustatory receptor
           candidate 55 protein.
          Length = 402

 Score = 22.2 bits (45), Expect = 3.4
 Identities = 11/30 (36%), Positives = 16/30 (53%)
 Frame = +1

Query: 301 LLLDVSPTKFVFLAQTPFVKVIDLEGTVDV 390
           + L +  T F FLA+   +K  D+   VDV
Sbjct: 99  MALTLIVTLFTFLARGTLIKSFDMLSHVDV 128


>AM292332-1|CAL23144.2|  344|Tribolium castaneum gustatory receptor
           candidate 11 protein.
          Length = 344

 Score = 22.2 bits (45), Expect = 3.4
 Identities = 11/30 (36%), Positives = 16/30 (53%)
 Frame = +1

Query: 301 LLLDVSPTKFVFLAQTPFVKVIDLEGTVDV 390
           + L +  T F FLA+   +K  D+   VDV
Sbjct: 99  MALTLIVTLFTFLARGTLIKSFDMLSHVDV 128


>DQ855506-1|ABH88193.1|  124|Tribolium castaneum chemosensory
           protein 20 protein.
          Length = 124

 Score = 21.8 bits (44), Expect = 4.5
 Identities = 8/14 (57%), Positives = 12/14 (85%)
 Frame = +2

Query: 71  DKKKQGHKTSVRYL 112
           DK+KQG KT +++L
Sbjct: 79  DKQKQGAKTVIQHL 92


>AF017415-2|AAB70263.1|  284|Tribolium castaneum abdominal-A
           protein.
          Length = 284

 Score = 21.8 bits (44), Expect = 4.5
 Identities = 8/29 (27%), Positives = 16/29 (55%)
 Frame = +2

Query: 221 VPEPNRYILES*SAYVTPLSALIASPNCC 307
           +P+  RY   S + +++P   ++  PN C
Sbjct: 127 IPDIPRYPWMSITDWMSPFDRVVCGPNGC 155


>AF017415-1|AAB70262.1|  343|Tribolium castaneum abdominal-AII
           protein.
          Length = 343

 Score = 21.8 bits (44), Expect = 4.5
 Identities = 8/29 (27%), Positives = 16/29 (55%)
 Frame = +2

Query: 221 VPEPNRYILES*SAYVTPLSALIASPNCC 307
           +P+  RY   S + +++P   ++  PN C
Sbjct: 186 IPDIPRYPWMSITDWMSPFDRVVCGPNGC 214


>AJ415419-1|CAC94468.1|  441|Tribolium castaneum transcription
           factor protein.
          Length = 441

 Score = 21.4 bits (43), Expect = 6.0
 Identities = 6/14 (42%), Positives = 10/14 (71%)
 Frame = +2

Query: 503 KRRPQALYRRSFGP 544
           K RP ++Y+R + P
Sbjct: 207 KERPDSIYQREYSP 220


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 142,689
Number of Sequences: 336
Number of extensions: 3063
Number of successful extensions: 8
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8
length of database: 122,585
effective HSP length: 54
effective length of database: 104,441
effective search space used: 15039504
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).