SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0033
         (698 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U81040-1|AAB39356.1|  283|Tribolium castaneum TC Deformed protein.     25   0.59 
U81038-1|AAB39355.1|  412|Tribolium castaneum transcription fact...    25   0.59 
AF321227-3|AAK16423.1|  412|Tribolium castaneum Dfd protein.           25   0.59 
AF243042-1|AAF68438.1|  126|Tribolium castaneum mutant transcrip...    25   0.59 
AM292368-1|CAL23180.2|  387|Tribolium castaneum gustatory recept...    24   1.0  
AM292347-1|CAL23159.2|  387|Tribolium castaneum gustatory recept...    24   1.0  
AM292327-1|CAL23139.2|  387|Tribolium castaneum gustatory recept...    24   1.0  
AM292322-1|CAL23134.1|  373|Tribolium castaneum gustatory recept...    23   2.4  
L01617-1|AAA30097.1|   46|Tribolium castaneum zinc finger protei...    23   3.2  
EU019711-1|ABU25223.1|  534|Tribolium castaneum chitin deacetyla...    23   3.2  
AY695257-1|AAW21974.1|  224|Tribolium castaneum intermediate neu...    22   4.2  
AF317551-1|AAG39634.1|  312|Tribolium castaneum distal-less prot...    21   9.7  

>U81040-1|AAB39356.1|  283|Tribolium castaneum TC Deformed protein.
          Length = 283

 Score = 25.0 bits (52), Expect = 0.59
 Identities = 12/32 (37%), Positives = 16/32 (50%)
 Frame = -2

Query: 253 EYRRNGQIPPVSRITRDHHVFGVEHLQRQLGY 158
           EY +N  IPP      +HH   ++  Q Q GY
Sbjct: 36  EYNQNSYIPPGGDFFGNHH---IQQQQLQYGY 64


>U81038-1|AAB39355.1|  412|Tribolium castaneum transcription factor
           Deformed protein.
          Length = 412

 Score = 25.0 bits (52), Expect = 0.59
 Identities = 12/32 (37%), Positives = 16/32 (50%)
 Frame = -2

Query: 253 EYRRNGQIPPVSRITRDHHVFGVEHLQRQLGY 158
           EY +N  IPP      +HH   ++  Q Q GY
Sbjct: 36  EYNQNSYIPPGGDFFGNHH---IQQQQLQYGY 64


>AF321227-3|AAK16423.1|  412|Tribolium castaneum Dfd protein.
          Length = 412

 Score = 25.0 bits (52), Expect = 0.59
 Identities = 12/32 (37%), Positives = 16/32 (50%)
 Frame = -2

Query: 253 EYRRNGQIPPVSRITRDHHVFGVEHLQRQLGY 158
           EY +N  IPP      +HH   ++  Q Q GY
Sbjct: 36  EYNQNSYIPPGGDFFGNHH---IQQQQLQYGY 64


>AF243042-1|AAF68438.1|  126|Tribolium castaneum mutant
           transcription factor TcDfd1 protein.
          Length = 126

 Score = 25.0 bits (52), Expect = 0.59
 Identities = 12/32 (37%), Positives = 16/32 (50%)
 Frame = -2

Query: 253 EYRRNGQIPPVSRITRDHHVFGVEHLQRQLGY 158
           EY +N  IPP      +HH   ++  Q Q GY
Sbjct: 36  EYNQNSYIPPGGDFFGNHH---IQQQQLQYGY 64


>AM292368-1|CAL23180.2|  387|Tribolium castaneum gustatory receptor
           candidate 47 protein.
          Length = 387

 Score = 24.2 bits (50), Expect = 1.0
 Identities = 14/41 (34%), Positives = 23/41 (56%), Gaps = 2/41 (4%)
 Frame = -1

Query: 320 YVLFLF*IFASCSSTSFIDI--RP*ISSQRSNTSRVEDHTR 204
           Y LFL  +F  CS  + ++I  R  ++  + N S+V+  TR
Sbjct: 291 YCLFLLFVFCDCSHQASLNIARRVQVTLLQVNLSQVDPATR 331


>AM292347-1|CAL23159.2|  387|Tribolium castaneum gustatory receptor
           candidate 26 protein.
          Length = 387

 Score = 24.2 bits (50), Expect = 1.0
 Identities = 14/41 (34%), Positives = 23/41 (56%), Gaps = 2/41 (4%)
 Frame = -1

Query: 320 YVLFLF*IFASCSSTSFIDI--RP*ISSQRSNTSRVEDHTR 204
           Y LFL  +F  CS  + ++I  R  ++  + N S+V+  TR
Sbjct: 291 YCLFLLFVFCDCSHQASLNIARRVQVTLLQVNLSQVDPATR 331


>AM292327-1|CAL23139.2|  387|Tribolium castaneum gustatory receptor
           candidate 6 protein.
          Length = 387

 Score = 24.2 bits (50), Expect = 1.0
 Identities = 14/41 (34%), Positives = 23/41 (56%), Gaps = 2/41 (4%)
 Frame = -1

Query: 320 YVLFLF*IFASCSSTSFIDI--RP*ISSQRSNTSRVEDHTR 204
           Y LFL  +F  CS  + ++I  R  ++  + N S+V+  TR
Sbjct: 291 YCLFLLFVFCDCSHQASLNIARRVQVTLLQVNLSQVDPATR 331


>AM292322-1|CAL23134.1|  373|Tribolium castaneum gustatory receptor
           candidate 1 protein.
          Length = 373

 Score = 23.0 bits (47), Expect = 2.4
 Identities = 12/24 (50%), Positives = 14/24 (58%)
 Frame = -3

Query: 330 LDKIRAVFVLNIRQLLVNFFHRHS 259
           L  +R VFV +    LVNF HR S
Sbjct: 10  LHSVRIVFVQSEIFCLVNFNHRES 33


>L01617-1|AAA30097.1|   46|Tribolium castaneum zinc finger protein
           protein.
          Length = 46

 Score = 22.6 bits (46), Expect = 3.2
 Identities = 9/29 (31%), Positives = 13/29 (44%)
 Frame = +1

Query: 91  AFLHPWLCAADVARSSTVSSFNCTRADAA 177
           AF  PWL    +   +    F+CT  + A
Sbjct: 16  AFSRPWLLQGHIRTHTGEKPFSCTYCNRA 44


>EU019711-1|ABU25223.1|  534|Tribolium castaneum chitin deacetylase
           1 protein.
          Length = 534

 Score = 22.6 bits (46), Expect = 3.2
 Identities = 5/14 (35%), Positives = 11/14 (78%)
 Frame = +1

Query: 331 WIPNNCKIAVCDIP 372
           W+P++CK+   ++P
Sbjct: 493 WVPHSCKLTSKEVP 506


>AY695257-1|AAW21974.1|  224|Tribolium castaneum intermediate
           neuroblasts defectiveprotein protein.
          Length = 224

 Score = 22.2 bits (45), Expect = 4.2
 Identities = 9/23 (39%), Positives = 14/23 (60%)
 Frame = +2

Query: 386 KWLRPSLVTRRPYRPYSRGCLSS 454
           ++L PSL   RP  PY +  ++S
Sbjct: 23  RYLPPSLSDTRPMLPYPQNYINS 45


>AF317551-1|AAG39634.1|  312|Tribolium castaneum distal-less
           protein.
          Length = 312

 Score = 21.0 bits (42), Expect = 9.7
 Identities = 11/28 (39%), Positives = 14/28 (50%)
 Frame = +2

Query: 401 SLVTRRPYRPYSRGCLSSSWLCLGGKPS 484
           +LVT    RP +R C  +  L L G  S
Sbjct: 237 ALVTSPRARPLARTCRDNRLLVLAGTSS 264


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 154,834
Number of Sequences: 336
Number of extensions: 3403
Number of successful extensions: 15
Number of sequences better than 10.0: 12
Number of HSP's better than 10.0 without gapping: 15
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 15
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 18426585
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).