SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0032
         (648 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292354-1|CAL23166.1|  321|Tribolium castaneum gustatory recept...    23   2.9  
DQ855492-1|ABH88179.1|  251|Tribolium castaneum chemosensory pro...    22   3.8  
AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr...    22   5.0  
AJ829922-1|CAH25640.1|  193|Tribolium castaneum twist bHLH trans...    21   6.6  
AY887136-1|AAW78361.1|  580|Tribolium castaneum vasa RNA helicas...    21   8.7  

>AM292354-1|CAL23166.1|  321|Tribolium castaneum gustatory receptor
           candidate 33 protein.
          Length = 321

 Score = 22.6 bits (46), Expect = 2.9
 Identities = 9/21 (42%), Positives = 13/21 (61%)
 Frame = -2

Query: 89  RARPLLLQNRTKLILHGNTIQ 27
           R +  L QNR + + HG T+Q
Sbjct: 163 RLKAQLWQNRYETVAHGMTVQ 183


>DQ855492-1|ABH88179.1|  251|Tribolium castaneum chemosensory
           protein 6 protein.
          Length = 251

 Score = 22.2 bits (45), Expect = 3.8
 Identities = 9/22 (40%), Positives = 13/22 (59%)
 Frame = +1

Query: 472 LXANCXRRTESWKTGAVLNLKR 537
           L  NC + TE  +T A  ++KR
Sbjct: 68  LQTNCAKCTEKQRTAAYRSIKR 89


>AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like
           protein protein.
          Length = 1156

 Score = 21.8 bits (44), Expect = 5.0
 Identities = 14/51 (27%), Positives = 21/51 (41%)
 Frame = +2

Query: 365 RVXTMSLPRASAPPGATPQRDYRPVPRHQF*CQTRD*XRTVTGELKAGKQV 517
           RV +++  R   PPG       R  P  +    T D  +   GE+   K+V
Sbjct: 820 RVESLTPERKMEPPGVPLNSTPRSTPDKREKSPTSDKAQEADGEVVVKKEV 870


>AJ829922-1|CAH25640.1|  193|Tribolium castaneum twist bHLH
           transcription factor protein.
          Length = 193

 Score = 21.4 bits (43), Expect = 6.6
 Identities = 11/36 (30%), Positives = 19/36 (52%)
 Frame = -2

Query: 530 KLSTAPVFQLSVRLXQFAXNL*SDIKIGDVELVDNL 423
           KLS     +L+ R   F  ++ S+    DV+L+ N+
Sbjct: 130 KLSKIQTLKLAARYIDFLYHVLSNENALDVDLIGNV 165


>AY887136-1|AAW78361.1|  580|Tribolium castaneum vasa RNA helicase
           protein.
          Length = 580

 Score = 21.0 bits (42), Expect = 8.7
 Identities = 12/38 (31%), Positives = 17/38 (44%)
 Frame = -3

Query: 271 RVLXISFRXSKKNSSSCASLPLTEARTRXMRSMYFPTQ 158
           R+L + F    +   S  S+P T  R   M S  FP +
Sbjct: 320 RMLDMGFLGDVEEMLSHQSMPATGERQTLMFSATFPEE 357


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 116,214
Number of Sequences: 336
Number of extensions: 1866
Number of successful extensions: 6
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 16656800
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).