SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0028
         (598 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM295015-1|CAL25730.1|  549|Tribolium castaneum ecdysone recepto...    27   0.16 
DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro...    26   0.28 
AY052624-1|AAL15472.1|  212|Tribolium castaneum kynurenine 3-mon...    21   7.9  
AY052393-1|AAL15467.1|  445|Tribolium castaneum kynurenine 3-mon...    21   7.9  
AY052391-1|AAL15465.1|  445|Tribolium castaneum kynurenine 3-mon...    21   7.9  
AM292382-1|CAL23194.2|  670|Tribolium castaneum gustatory recept...    21   7.9  
AF442747-1|AAL40947.1|  669|Tribolium castaneum ABC transmembran...    21   7.9  
AF422804-1|AAL56571.1|  669|Tribolium castaneum ABC transmembran...    21   7.9  
AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr...    21   7.9  

>AM295015-1|CAL25730.1|  549|Tribolium castaneum ecdysone receptor
           (isoform A) protein.
          Length = 549

 Score = 26.6 bits (56), Expect = 0.16
 Identities = 15/40 (37%), Positives = 22/40 (55%), Gaps = 1/40 (2%)
 Frame = -3

Query: 137 PSGT-PSMSPQKGSPASQPYTLXRN*TVAAVSSRRNSPHT 21
           PSG  P ++P  G P S PYT+  N   + +SS    P++
Sbjct: 110 PSGNVPPLTPSPGPP-SHPYTVISNGYSSPMSSGSYDPYS 148


>DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein.
          Length = 2700

 Score = 25.8 bits (54), Expect = 0.28
 Identities = 13/32 (40%), Positives = 16/32 (50%), Gaps = 3/32 (9%)
 Frame = +1

Query: 172  NRKCFREGESRRAPSAGPML---PVAAVTRRP 258
            N +C  +  S  APS  PM+   PV   T RP
Sbjct: 2281 NTECHPDASSTMAPSTTPMVPDKPVTTTTSRP 2312


>AY052624-1|AAL15472.1|  212|Tribolium castaneum kynurenine
           3-monooxygenase protein.
          Length = 212

 Score = 21.0 bits (42), Expect = 7.9
 Identities = 15/56 (26%), Positives = 24/56 (42%)
 Frame = +1

Query: 1   VRCTRFCVCGEFLRLLTAATVQFLXNVYGCEAGDPFCGDIDGVPLGQRGVLPGSTQ 168
           V+C  + V  +FL +  AA         G  AG   C  +DG+   +   + GS +
Sbjct: 54  VKCKPYHVGSKFLLIGDAAHAMVPFYGQGMNAGFEDCFLLDGILERRSNDIAGSIE 109


>AY052393-1|AAL15467.1|  445|Tribolium castaneum kynurenine
           3-monooxygenase protein.
          Length = 445

 Score = 21.0 bits (42), Expect = 7.9
 Identities = 15/56 (26%), Positives = 24/56 (42%)
 Frame = +1

Query: 1   VRCTRFCVCGEFLRLLTAATVQFLXNVYGCEAGDPFCGDIDGVPLGQRGVLPGSTQ 168
           V+C  + V  +FL +  AA         G  AG   C  +DG+   +   + GS +
Sbjct: 287 VKCKPYHVGSKFLLIGDAAHAMVPFYGQGMNAGFEDCFLLDGILERRSNDIAGSIE 342


>AY052391-1|AAL15465.1|  445|Tribolium castaneum kynurenine
           3-monooxygenase protein.
          Length = 445

 Score = 21.0 bits (42), Expect = 7.9
 Identities = 15/56 (26%), Positives = 24/56 (42%)
 Frame = +1

Query: 1   VRCTRFCVCGEFLRLLTAATVQFLXNVYGCEAGDPFCGDIDGVPLGQRGVLPGSTQ 168
           V+C  + V  +FL +  AA         G  AG   C  +DG+   +   + GS +
Sbjct: 287 VKCKPYHVGSKFLLIGDAAHAMVPFYGQGMNAGFEDCFLLDGILERRSNDIAGSIE 342


>AM292382-1|CAL23194.2|  670|Tribolium castaneum gustatory receptor
           candidate 61 protein.
          Length = 670

 Score = 21.0 bits (42), Expect = 7.9
 Identities = 8/33 (24%), Positives = 14/33 (42%)
 Frame = +1

Query: 16  FCVCGEFLRLLTAATVQFLXNVYGCEAGDPFCG 114
           F + G F   +  A   ++  +Y  +   P CG
Sbjct: 637 FPINGSFAFTVVGAATTYITIIYQFQVNKPTCG 669


>AF442747-1|AAL40947.1|  669|Tribolium castaneum ABC transmembrane
           transporter protein.
          Length = 669

 Score = 21.0 bits (42), Expect = 7.9
 Identities = 9/11 (81%), Positives = 10/11 (90%)
 Frame = -2

Query: 339 ELLAVLNSSGA 307
           ELLA+L SSGA
Sbjct: 105 ELLAILGSSGA 115


>AF422804-1|AAL56571.1|  669|Tribolium castaneum ABC transmembrane
           transporter white protein.
          Length = 669

 Score = 21.0 bits (42), Expect = 7.9
 Identities = 9/11 (81%), Positives = 10/11 (90%)
 Frame = -2

Query: 339 ELLAVLNSSGA 307
           ELLA+L SSGA
Sbjct: 105 ELLAILGSSGA 115


>AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like
           protein protein.
          Length = 1156

 Score = 21.0 bits (42), Expect = 7.9
 Identities = 10/25 (40%), Positives = 13/25 (52%), Gaps = 4/25 (16%)
 Frame = -3

Query: 146 PRCPSGTPSMSPQ----KGSPASQP 84
           PRCPSG   +S +    +G P   P
Sbjct: 96  PRCPSGESMLSERAALLRGVPTLSP 120


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 140,486
Number of Sequences: 336
Number of extensions: 2883
Number of successful extensions: 10
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 10
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 10
length of database: 122,585
effective HSP length: 54
effective length of database: 104,441
effective search space used: 15039504
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).