SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0023
         (289 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM295014-1|CAL25729.1|  407|Tribolium castaneum ultraspiracle nu...    28   0.023
DQ414246-1|ABD63008.1|  126|Tribolium castaneum odd-skipped prot...    22   1.5  
U81038-1|AAB39355.1|  412|Tribolium castaneum transcription fact...    20   4.6  
AM292340-1|CAL23152.1|  355|Tribolium castaneum gustatory recept...    20   4.6  
AF321227-3|AAK16423.1|  412|Tribolium castaneum Dfd protein.           20   4.6  
X91618-1|CAA62821.1|  524|Tribolium castaneum hunchback protein.       19   8.0  
DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro...    19   8.0  
AY052624-1|AAL15472.1|  212|Tribolium castaneum kynurenine 3-mon...    19   8.0  
AY052623-1|AAL15471.1|  101|Tribolium castaneum kynurenine 3-mon...    19   8.0  
AY052393-1|AAL15467.1|  445|Tribolium castaneum kynurenine 3-mon...    19   8.0  
AY052391-1|AAL15465.1|  445|Tribolium castaneum kynurenine 3-mon...    19   8.0  
AM292369-1|CAL23181.1|  408|Tribolium castaneum gustatory recept...    19   8.0  

>AM295014-1|CAL25729.1|  407|Tribolium castaneum ultraspiracle
           nuclear receptor protein.
          Length = 407

 Score = 27.9 bits (59), Expect = 0.023
 Identities = 11/27 (40%), Positives = 17/27 (62%)
 Frame = +2

Query: 128 AKYTCSFCGKDAMKRSCVGIWSCKRCK 208
           +K+ CS CG  A  +   G++SC+ CK
Sbjct: 82  SKHLCSICGDRASGKH-YGVYSCEGCK 107


>DQ414246-1|ABD63008.1|  126|Tribolium castaneum odd-skipped
           protein.
          Length = 126

 Score = 21.8 bits (44), Expect = 1.5
 Identities = 10/33 (30%), Positives = 15/33 (45%), Gaps = 1/33 (3%)
 Frame = +2

Query: 62  KYGTR-YGASLRKMVKKMEVTQHAKYTCSFCGK 157
           KY  R +  S   ++ +   T    Y+C  CGK
Sbjct: 83  KYCNRQFTKSYNLLIHERTHTDERPYSCDICGK 115


>U81038-1|AAB39355.1|  412|Tribolium castaneum transcription factor
           Deformed protein.
          Length = 412

 Score = 20.2 bits (40), Expect = 4.6
 Identities = 7/15 (46%), Positives = 11/15 (73%)
 Frame = +3

Query: 93  VKWSKRWK*PNTQSI 137
           +KW K  K PNT+++
Sbjct: 286 MKWKKDNKLPNTKNV 300


>AM292340-1|CAL23152.1|  355|Tribolium castaneum gustatory receptor
           candidate 19 protein.
          Length = 355

 Score = 20.2 bits (40), Expect = 4.6
 Identities = 12/39 (30%), Positives = 16/39 (41%)
 Frame = -1

Query: 160 ILTTK*ASILCVLGYFHLFDHFT*RGTVTCAIFASNSNL 44
           I T     +LC+  +F  F  FT      CA    N +L
Sbjct: 155 IFTVHLLFLLCIYHFFCAFIIFTMHLLFCCAFIFFNMHL 193


>AF321227-3|AAK16423.1|  412|Tribolium castaneum Dfd protein.
          Length = 412

 Score = 20.2 bits (40), Expect = 4.6
 Identities = 7/15 (46%), Positives = 11/15 (73%)
 Frame = +3

Query: 93  VKWSKRWK*PNTQSI 137
           +KW K  K PNT+++
Sbjct: 286 MKWKKDNKLPNTKNV 300


>X91618-1|CAA62821.1|  524|Tribolium castaneum hunchback protein.
          Length = 524

 Score = 19.4 bits (38), Expect = 8.0
 Identities = 5/10 (50%), Positives = 7/10 (70%)
 Frame = +2

Query: 125 HAKYTCSFCG 154
           H  +TC+ CG
Sbjct: 496 HNPFTCNMCG 505


>DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein.
          Length = 2700

 Score = 19.4 bits (38), Expect = 8.0
 Identities = 10/37 (27%), Positives = 14/37 (37%)
 Frame = -2

Query: 234  TQAPPATVLLHRLQDQMPTQERFIASLPQNEQVYFAC 124
            T  PPA V+    +   P +       P N   Y+ C
Sbjct: 1085 TIPPPAVVMPEVDKPSQPCEPGQYVPDPHNCNAYYRC 1121


>AY052624-1|AAL15472.1|  212|Tribolium castaneum kynurenine
           3-monooxygenase protein.
          Length = 212

 Score = 19.4 bits (38), Expect = 8.0
 Identities = 9/22 (40%), Positives = 11/22 (50%)
 Frame = -3

Query: 158 PYHKMSKYTLRVGLLPSF*PFY 93
           PYH  SK+ L      +  PFY
Sbjct: 58  PYHVGSKFLLIGDAAHAMVPFY 79


>AY052623-1|AAL15471.1|  101|Tribolium castaneum kynurenine
           3-monooxygenase protein.
          Length = 101

 Score = 19.4 bits (38), Expect = 8.0
 Identities = 9/22 (40%), Positives = 11/22 (50%)
 Frame = -3

Query: 158 PYHKMSKYTLRVGLLPSF*PFY 93
           PYH  SK+ L      +  PFY
Sbjct: 73  PYHVGSKFLLIGDAAHAMVPFY 94


>AY052393-1|AAL15467.1|  445|Tribolium castaneum kynurenine
           3-monooxygenase protein.
          Length = 445

 Score = 19.4 bits (38), Expect = 8.0
 Identities = 9/22 (40%), Positives = 11/22 (50%)
 Frame = -3

Query: 158 PYHKMSKYTLRVGLLPSF*PFY 93
           PYH  SK+ L      +  PFY
Sbjct: 291 PYHVGSKFLLIGDAAHAMVPFY 312


>AY052391-1|AAL15465.1|  445|Tribolium castaneum kynurenine
           3-monooxygenase protein.
          Length = 445

 Score = 19.4 bits (38), Expect = 8.0
 Identities = 9/22 (40%), Positives = 11/22 (50%)
 Frame = -3

Query: 158 PYHKMSKYTLRVGLLPSF*PFY 93
           PYH  SK+ L      +  PFY
Sbjct: 291 PYHVGSKFLLIGDAAHAMVPFY 312


>AM292369-1|CAL23181.1|  408|Tribolium castaneum gustatory receptor
           candidate 48 protein.
          Length = 408

 Score = 19.4 bits (38), Expect = 8.0
 Identities = 8/23 (34%), Positives = 12/23 (52%)
 Frame = -1

Query: 181 DTRTFHSILTTK*ASILCVLGYF 113
           DTR+ HS+   K   +L    +F
Sbjct: 10  DTRSTHSMKNFKYLKVLVTFAHF 32


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 78,116
Number of Sequences: 336
Number of extensions: 1770
Number of successful extensions: 20
Number of sequences better than 10.0: 12
Number of HSP's better than 10.0 without gapping: 16
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 20
length of database: 122,585
effective HSP length: 48
effective length of database: 106,457
effective search space used:  5003479
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 37 (19.9 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).