SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0020
         (598 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ...    25   0.48 
AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ...    25   0.48 
AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ...    25   0.48 
AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ...    25   0.48 
AM292381-1|CAL23193.2|  364|Tribolium castaneum gustatory recept...    25   0.64 
AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ...    24   0.85 
AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ...    24   0.85 
AM292361-1|CAL23173.2|  373|Tribolium castaneum gustatory recept...    23   2.0  
AM292340-1|CAL23152.1|  355|Tribolium castaneum gustatory recept...    23   2.0  
AM292337-1|CAL23149.2|  452|Tribolium castaneum gustatory recept...    21   6.0  

>AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase
            variant 2 protein.
          Length = 1558

 Score = 25.0 bits (52), Expect = 0.48
 Identities = 9/21 (42%), Positives = 15/21 (71%)
 Frame = -1

Query: 151  IITFFIAVILVIQYFAFVLYK 89
            +  FF A+ILVIQ+ A + ++
Sbjct: 1329 VFVFFFALILVIQFVAMLFHR 1349


>AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase
            variant 1 protein.
          Length = 1558

 Score = 25.0 bits (52), Expect = 0.48
 Identities = 9/21 (42%), Positives = 15/21 (71%)
 Frame = -1

Query: 151  IITFFIAVILVIQYFAFVLYK 89
            +  FF A+ILVIQ+ A + ++
Sbjct: 1329 VFVFFFALILVIQFVAMLFHR 1349


>AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B
            protein.
          Length = 1558

 Score = 25.0 bits (52), Expect = 0.48
 Identities = 9/21 (42%), Positives = 15/21 (71%)
 Frame = -1

Query: 151  IITFFIAVILVIQYFAFVLYK 89
            +  FF A+ILVIQ+ A + ++
Sbjct: 1329 VFVFFFALILVIQFVAMLFHR 1349


>AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A
            protein.
          Length = 1558

 Score = 25.0 bits (52), Expect = 0.48
 Identities = 9/21 (42%), Positives = 15/21 (71%)
 Frame = -1

Query: 151  IITFFIAVILVIQYFAFVLYK 89
            +  FF A+ILVIQ+ A + ++
Sbjct: 1329 VFVFFFALILVIQFVAMLFHR 1349


>AM292381-1|CAL23193.2|  364|Tribolium castaneum gustatory receptor
           candidate 60 protein.
          Length = 364

 Score = 24.6 bits (51), Expect = 0.64
 Identities = 13/26 (50%), Positives = 16/26 (61%)
 Frame = +3

Query: 75  TNFIRLYNTKAKY*ITRITAIKNVII 152
           T +I L N +AKY  T I  IKN +I
Sbjct: 235 TLYIILTNNQAKYCTTLIGLIKNCVI 260


>AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase
            protein.
          Length = 1464

 Score = 24.2 bits (50), Expect = 0.85
 Identities = 7/21 (33%), Positives = 16/21 (76%)
 Frame = -1

Query: 151  IITFFIAVILVIQYFAFVLYK 89
            +   F A+++VIQ+FA ++++
Sbjct: 1286 VFLIFFALLMVIQFFAMMIHR 1306


>AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2
            protein.
          Length = 1464

 Score = 24.2 bits (50), Expect = 0.85
 Identities = 7/21 (33%), Positives = 16/21 (76%)
 Frame = -1

Query: 151  IITFFIAVILVIQYFAFVLYK 89
            +   F A+++VIQ+FA ++++
Sbjct: 1286 VFLIFFALLMVIQFFAMMIHR 1306


>AM292361-1|CAL23173.2|  373|Tribolium castaneum gustatory receptor
           candidate 40 protein.
          Length = 373

 Score = 23.0 bits (47), Expect = 2.0
 Identities = 10/35 (28%), Positives = 20/35 (57%)
 Frame = -2

Query: 372 LMRKNGLEQQYCHIYFSQHNYMSFASVLV*LGVLF 268
           L+  NG+  + C++ FS ++   F S ++  G +F
Sbjct: 209 LLPVNGVTSEKCNLTFSWYSKKVFYSKIIISGSIF 243


>AM292340-1|CAL23152.1|  355|Tribolium castaneum gustatory receptor
           candidate 19 protein.
          Length = 355

 Score = 23.0 bits (47), Expect = 2.0
 Identities = 15/49 (30%), Positives = 22/49 (44%)
 Frame = -1

Query: 148 ITFFIAVILVIQYFAFVLYKRIKFV*QYYFFIKLNIIKLRIPFKI*IYY 2
           I F +  +L   YF    Y  I  +  YYF+    I  + + F + IYY
Sbjct: 90  IIFTVHFLLCTYYF---YYAFIILLCVYYFYYAFIIFTVHLLFLLCIYY 135


>AM292337-1|CAL23149.2|  452|Tribolium castaneum gustatory receptor
           candidate 16 protein.
          Length = 452

 Score = 21.4 bits (43), Expect = 6.0
 Identities = 11/30 (36%), Positives = 18/30 (60%)
 Frame = -1

Query: 505 LLYFLHSVSAVFTL**NITTIFVIQSDDLV 416
           ++ FL  VS  F L  ++ T+F+ +  DLV
Sbjct: 136 MVVFLIGVSLSFNLFGDLLTLFIKEELDLV 165


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 129,427
Number of Sequences: 336
Number of extensions: 2791
Number of successful extensions: 10
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 10
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 10
length of database: 122,585
effective HSP length: 54
effective length of database: 104,441
effective search space used: 15039504
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).