SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0018
         (678 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept...    24   1.3  
AM295015-1|CAL25730.1|  549|Tribolium castaneum ecdysone recepto...    23   2.3  
AF263514-1|AAF74206.1|  127|Tribolium castaneum cytochrome P450 ...    22   4.0  
S73225-1|AAB30811.1|  327|Tribolium castaneum protein ( Triboliu...    22   5.3  
AY043293-2|AAK96034.1|  353|Tribolium castaneum homeodomain tran...    21   7.0  
AM292330-1|CAL23142.2|  408|Tribolium castaneum gustatory recept...    21   7.0  
AF231104-1|AAF64149.1|  142|Tribolium castaneum labial protein p...    21   7.0  
AF231103-1|AAF64148.1|  142|Tribolium castaneum labial protein p...    21   7.0  
DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad...    21   9.3  

>AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor
            candidate 46 protein.
          Length = 1451

 Score = 23.8 bits (49), Expect = 1.3
 Identities = 11/21 (52%), Positives = 13/21 (61%)
 Frame = -2

Query: 506  CVYFLSLCGIVVWEFCEGFRL 444
            CVY L LCG  V+EF    R+
Sbjct: 1131 CVY-LFLCGFCVYEFASDERI 1150


>AM295015-1|CAL25730.1|  549|Tribolium castaneum ecdysone receptor
           (isoform A) protein.
          Length = 549

 Score = 23.0 bits (47), Expect = 2.3
 Identities = 11/26 (42%), Positives = 14/26 (53%)
 Frame = +1

Query: 211 SVLKASSTIGGYLSSVCISTVRRNKK 288
           SVL    T+G   S +C S   +NKK
Sbjct: 509 SVLTELRTLGNQNSEMCFSLKLKNKK 534


>AF263514-1|AAF74206.1|  127|Tribolium castaneum cytochrome P450
           monooxygenase protein.
          Length = 127

 Score = 22.2 bits (45), Expect = 4.0
 Identities = 8/20 (40%), Positives = 13/20 (65%)
 Frame = -2

Query: 281 FLRTVLMQTLERYPPIVELA 222
           +L   LM+TL  +PP+  +A
Sbjct: 47  YLERCLMETLRMFPPVPIIA 66


>S73225-1|AAB30811.1|  327|Tribolium castaneum protein ( Tribolium
           castaneum homeodomainprotein mRNA, complete cds. ).
          Length = 327

 Score = 21.8 bits (44), Expect = 5.3
 Identities = 8/11 (72%), Positives = 10/11 (90%)
 Frame = +2

Query: 425 RSPRTRKVETP 457
           RSPRTR+V+ P
Sbjct: 207 RSPRTRRVKKP 217


>AY043293-2|AAK96034.1|  353|Tribolium castaneum homeodomain
           transcription factor Labialprotein.
          Length = 353

 Score = 21.4 bits (43), Expect = 7.0
 Identities = 12/32 (37%), Positives = 14/32 (43%)
 Frame = +1

Query: 229 STIGGYLSSVCISTVRRNKKRFMLCSQEKEKH 324
           S     LS  C++T R N     L   EKE H
Sbjct: 242 SNTSSMLSLNCLNTGRTNFTNKQLTELEKEFH 273


>AM292330-1|CAL23142.2|  408|Tribolium castaneum gustatory receptor
           candidate 9 protein.
          Length = 408

 Score = 21.4 bits (43), Expect = 7.0
 Identities = 10/20 (50%), Positives = 13/20 (65%)
 Frame = -2

Query: 365 FVSS*LLI*LAMAVCFSFSW 306
           F+S  LLI   ++VCF  SW
Sbjct: 322 FISLGLLILRLVSVCFYGSW 341


>AF231104-1|AAF64149.1|  142|Tribolium castaneum labial protein
           protein.
          Length = 142

 Score = 21.4 bits (43), Expect = 7.0
 Identities = 12/32 (37%), Positives = 14/32 (43%)
 Frame = +1

Query: 229 STIGGYLSSVCISTVRRNKKRFMLCSQEKEKH 324
           S     LS  C++T R N     L   EKE H
Sbjct: 31  SNTSSMLSLNCLNTGRTNFTNKQLTELEKEFH 62


>AF231103-1|AAF64148.1|  142|Tribolium castaneum labial protein
           protein.
          Length = 142

 Score = 21.4 bits (43), Expect = 7.0
 Identities = 12/32 (37%), Positives = 14/32 (43%)
 Frame = +1

Query: 229 STIGGYLSSVCISTVRRNKKRFMLCSQEKEKH 324
           S     LS  C++T R N     L   EKE H
Sbjct: 31  SNTSSMLSLNCLNTGRTNFTNKQLTELEKEFH 62


>DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome
           adhesion molecule splicevariant 3.12.3.1 protein.
          Length = 1639

 Score = 21.0 bits (42), Expect = 9.3
 Identities = 8/34 (23%), Positives = 17/34 (50%)
 Frame = +3

Query: 141 VNDHGKTLGDLKTMVSKLSQNTVIGPESKLDDWR 242
           V   G  +GD+  +   L+   ++ P  + +D+R
Sbjct: 58  VRSDGTAVGDVPGLRQVLANGNLVFPPFRAEDYR 91


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 141,190
Number of Sequences: 336
Number of extensions: 2712
Number of successful extensions: 14
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 14
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 14
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 17697850
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).