SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0017
         (698 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292340-1|CAL23152.1|  355|Tribolium castaneum gustatory recept...    28   0.064
AM292377-1|CAL23189.2|  358|Tribolium castaneum gustatory recept...    25   0.45 
DQ855499-1|ABH88186.1|  124|Tribolium castaneum chemosensory pro...    23   2.4  
AM292339-1|CAL23151.2|  387|Tribolium castaneum gustatory recept...    21   7.3  
AM292359-1|CAL23171.2|  436|Tribolium castaneum gustatory recept...    21   9.7  

>AM292340-1|CAL23152.1|  355|Tribolium castaneum gustatory receptor
           candidate 19 protein.
          Length = 355

 Score = 28.3 bits (60), Expect = 0.064
 Identities = 20/74 (27%), Positives = 35/74 (47%), Gaps = 2/74 (2%)
 Frame = -2

Query: 592 MYYNAPI*FLCLTYSFLRA*YKFSLNFCFFTTFICQ*YLHAMQCHA-IMFFVYLCF*ICL 416
           ++Y   I  LC+ Y F  A   F+++           Y+H + C A I+F ++L F +C+
Sbjct: 227 LFYCVLIILLCIYY-FYYAFILFTVHLLLLVCIYYFYYMHLLFCCAFIIFTMHLLFLLCI 285

Query: 415 LGTV*G-VVLFCFY 377
                  ++L C Y
Sbjct: 286 YYFYCALIILLCIY 299



 Score = 25.8 bits (54), Expect = 0.34
 Identities = 17/69 (24%), Positives = 30/69 (43%)
 Frame = -2

Query: 589 YYNAPI*FLCLTYSFLRA*YKFSLNFCFFTTFICQ*YLHAMQCHAIMFFVYLCF*ICLLG 410
           Y+   + FL   Y F  A   F+++  F+   I    ++      I+F V+L   +C+  
Sbjct: 201 YFTLHLLFLPCIYYFYSAFIIFTIHLLFYCVLIILLCIYYFYYAFILFTVHLLLLVCIYY 260

Query: 409 TV*GVVLFC 383
                +LFC
Sbjct: 261 FYYMHLLFC 269



 Score = 21.8 bits (44), Expect = 5.5
 Identities = 16/60 (26%), Positives = 27/60 (45%), Gaps = 6/60 (10%)
 Frame = -1

Query: 593 HVL*CTH------LISLPNLFFFKSLI*VLLKFLFFYNIHLPVVPTCDAMSCHNVFCLFM 432
           H L CT+      +I L   +F+ + I   +  LF   I+  VVP    +  +  +C F+
Sbjct: 95  HFLLCTYYFYYAFIILLCVYYFYYAFIIFTVHLLFLLCIYYFVVPLFFLLCIYYFYCAFI 154


>AM292377-1|CAL23189.2|  358|Tribolium castaneum gustatory receptor
           candidate 56 protein.
          Length = 358

 Score = 25.4 bits (53), Expect = 0.45
 Identities = 9/16 (56%), Positives = 11/16 (68%)
 Frame = +1

Query: 568 IKWVHYNTCEEVFKEC 615
           I W+   TCEEV K+C
Sbjct: 341 IVWITSETCEEVSKKC 356


>DQ855499-1|ABH88186.1|  124|Tribolium castaneum chemosensory
           protein 13 protein.
          Length = 124

 Score = 23.0 bits (47), Expect = 2.4
 Identities = 9/27 (33%), Positives = 17/27 (62%)
 Frame = -3

Query: 132 SIFNEKYLNNYKYLHDSVLKNRRIVFS 52
           ++ +E+Y N Y    D+ LK+ R++ S
Sbjct: 14  NVLSEEYTNQYNDELDAALKSERLMKS 40


>AM292339-1|CAL23151.2|  387|Tribolium castaneum gustatory receptor
           candidate 18 protein.
          Length = 387

 Score = 21.4 bits (43), Expect = 7.3
 Identities = 12/39 (30%), Positives = 20/39 (51%)
 Frame = +2

Query: 41  KVFILNTILLFFRTLSCKYL*LFRYFSLKMDMNNPPNQS 157
           ++F ++  LLF     C     + +  L+ D+NN  NQS
Sbjct: 345 RLFNIDNALLF---AICGSAFSYLFIMLQFDLNNKKNQS 380


>AM292359-1|CAL23171.2|  436|Tribolium castaneum gustatory receptor
           candidate 38 protein.
          Length = 436

 Score = 21.0 bits (42), Expect = 9.7
 Identities = 11/30 (36%), Positives = 15/30 (50%)
 Frame = -2

Query: 220 INKIIGTKYHIALIFSKYKPIALIWRVVHI 131
           INK    K+    I+   KPI  + R+V I
Sbjct: 47  INKSSTDKFGNGAIYEVLKPIYALMRIVGI 76


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 166,243
Number of Sequences: 336
Number of extensions: 3702
Number of successful extensions: 11
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 10
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 18426585
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).