SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0010
         (598 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292344-1|CAL23156.1|  291|Tribolium castaneum gustatory recept...    24   0.85 
AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept...    22   4.5  
AM292380-1|CAL23192.2|  489|Tribolium castaneum gustatory recept...    21   6.0  
AM292346-1|CAL23158.2|  314|Tribolium castaneum gustatory recept...    21   6.0  
AF227923-1|AAF36721.1|  351|Tribolium castaneum abdominal-B prot...    21   6.0  
AF321227-1|AAK16421.1|  290|Tribolium castaneum Ftz protein.           21   7.9  

>AM292344-1|CAL23156.1|  291|Tribolium castaneum gustatory receptor
           candidate 23 protein.
          Length = 291

 Score = 24.2 bits (50), Expect = 0.85
 Identities = 12/25 (48%), Positives = 13/25 (52%)
 Frame = -3

Query: 359 VYYLNRIVKWKIIEG*IFYFVSILI 285
           V Y NRI  W I+ G IF     LI
Sbjct: 148 VIYFNRIFGWNILFGHIFTVCRTLI 172


>AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor
           candidate 46 protein.
          Length = 1451

 Score = 21.8 bits (44), Expect = 4.5
 Identities = 10/23 (43%), Positives = 11/23 (47%)
 Frame = +3

Query: 456 LLYIQDCGSCYTENAFQKCQVLC 524
           LLYI   G  Y  + F  C V C
Sbjct: 632 LLYIFLVGIMYAADVFYICHVCC 654


>AM292380-1|CAL23192.2|  489|Tribolium castaneum gustatory receptor
           candidate 59 protein.
          Length = 489

 Score = 21.4 bits (43), Expect = 6.0
 Identities = 10/36 (27%), Positives = 18/36 (50%)
 Frame = -3

Query: 164 NYYY*NTCKIS*KNMRLFL*SVLLAHNLLIKETNSL 57
           N Y    CK++  + + FL  V + HN ++   N +
Sbjct: 199 NQYIKQVCKLNNGHYKNFLSQVEIIHNEILVTHNEI 234


>AM292346-1|CAL23158.2|  314|Tribolium castaneum gustatory receptor
           candidate 25 protein.
          Length = 314

 Score = 21.4 bits (43), Expect = 6.0
 Identities = 10/36 (27%), Positives = 18/36 (50%)
 Frame = -3

Query: 164 NYYY*NTCKIS*KNMRLFL*SVLLAHNLLIKETNSL 57
           N Y    CK++  + + FL  V + HN ++   N +
Sbjct: 24  NQYIKQVCKLNNGHYKNFLSQVEIIHNEILVTHNEI 59


>AF227923-1|AAF36721.1|  351|Tribolium castaneum abdominal-B
           protein.
          Length = 351

 Score = 21.4 bits (43), Expect = 6.0
 Identities = 10/33 (30%), Positives = 15/33 (45%)
 Frame = -2

Query: 336 QMENN*GLNLLFRQHPHHTFHTXNYIYQVVVYH 238
           Q +NN       + H HH  H  +  + VV +H
Sbjct: 308 QQQNNNNAATNNQNHHHHAGHHIHAQHHVVNHH 340


>AF321227-1|AAK16421.1|  290|Tribolium castaneum Ftz protein.
          Length = 290

 Score = 21.0 bits (42), Expect = 7.9
 Identities = 6/18 (33%), Positives = 11/18 (61%)
 Frame = -2

Query: 267 NYIYQVVVYHCYRYQPVY 214
           NY +   +YH  + +P+Y
Sbjct: 38  NYTHNNEMYHSVKEEPIY 55


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 139,040
Number of Sequences: 336
Number of extensions: 2908
Number of successful extensions: 12
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 11
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12
length of database: 122,585
effective HSP length: 54
effective length of database: 104,441
effective search space used: 15039504
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).