SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0008
         (698 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF442747-1|AAL40947.1|  669|Tribolium castaneum ABC transmembran...    24   1.4  
AF422804-1|AAL56571.1|  669|Tribolium castaneum ABC transmembran...    24   1.4  
EF125547-1|ABL73931.1|  255|Tribolium castaneum obstractor D pro...    23   1.8  
AY675073-1|AAV74190.1|  533|Tribolium castaneum chitinase 5 prot...    23   1.8  
AJ005083-1|CAB65469.1|  585|Tribolium castaneum signal receptor ...    21   9.7  

>AF442747-1|AAL40947.1|  669|Tribolium castaneum ABC transmembrane
           transporter protein.
          Length = 669

 Score = 23.8 bits (49), Expect = 1.4
 Identities = 9/19 (47%), Positives = 13/19 (68%)
 Frame = -3

Query: 342 HSTWGIRHSHLRCIRGIPV 286
           H++  +  S LRC+ GIPV
Sbjct: 127 HTSSNLTVSGLRCVNGIPV 145


>AF422804-1|AAL56571.1|  669|Tribolium castaneum ABC transmembrane
           transporter white protein.
          Length = 669

 Score = 23.8 bits (49), Expect = 1.4
 Identities = 9/19 (47%), Positives = 13/19 (68%)
 Frame = -3

Query: 342 HSTWGIRHSHLRCIRGIPV 286
           H++  +  S LRC+ GIPV
Sbjct: 127 HTSSNLTVSGLRCVNGIPV 145


>EF125547-1|ABL73931.1|  255|Tribolium castaneum obstractor D
           protein.
          Length = 255

 Score = 23.4 bits (48), Expect = 1.8
 Identities = 10/26 (38%), Positives = 14/26 (53%)
 Frame = -2

Query: 553 RCSSAVKYSRRRLTLGSPPTGVCWMP 476
           RC + + + RR L    PPT  C +P
Sbjct: 185 RCPAMLVFDRRSLRCVVPPTEDCDVP 210



 Score = 21.0 bits (42), Expect = 9.7
 Identities = 7/15 (46%), Positives = 8/15 (53%)
 Frame = -1

Query: 101 KTRQHNINNAPNCFP 57
           K +QHN N  P   P
Sbjct: 232 KNKQHNFNLPPGAIP 246


>AY675073-1|AAV74190.1|  533|Tribolium castaneum chitinase 5
           protein.
          Length = 533

 Score = 23.4 bits (48), Expect = 1.8
 Identities = 18/64 (28%), Positives = 25/64 (39%), Gaps = 3/64 (4%)
 Frame = +3

Query: 243 HSCCGCRKPKIPENALECHEYIEDENVEFPTC---CARLRCVVEVNGERIVQTRGQPGEL 413
           H  CG + P I       + Y   E     T     AR       +G + VQT  +PG+ 
Sbjct: 377 HGLCGPKNPLINILYANMNSYSVPEPTISTTPRPEWARPPSTPSADGSKPVQTTPKPGQW 436

Query: 414 FPDK 425
            P+K
Sbjct: 437 VPEK 440


>AJ005083-1|CAB65469.1|  585|Tribolium castaneum signal receptor
           protein protein.
          Length = 585

 Score = 21.0 bits (42), Expect = 9.7
 Identities = 6/10 (60%), Positives = 8/10 (80%)
 Frame = +1

Query: 178 QEWSDHYTCH 207
           Q+ + HYTCH
Sbjct: 77  QDHTTHYTCH 86


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 175,387
Number of Sequences: 336
Number of extensions: 3970
Number of successful extensions: 9
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 18426585
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).