SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0007
         (618 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292340-1|CAL23152.1|  355|Tribolium castaneum gustatory recept...    27   0.095
DQ855499-1|ABH88186.1|  124|Tribolium castaneum chemosensory pro...    23   2.1  
AM292339-1|CAL23151.2|  387|Tribolium castaneum gustatory recept...    21   6.3  
AM292359-1|CAL23171.2|  436|Tribolium castaneum gustatory recept...    21   8.3  

>AM292340-1|CAL23152.1|  355|Tribolium castaneum gustatory receptor
           candidate 19 protein.
          Length = 355

 Score = 27.5 bits (58), Expect = 0.095
 Identities = 18/67 (26%), Positives = 34/67 (50%), Gaps = 2/67 (2%)
 Frame = -3

Query: 571 LISLPNLFFFKSLI*VLLKFLIFYNIHLQ*YLHAMQCHA-IMFFVYLCF*ICLLGTV*G- 398
           +I L   +F+ + I   +  L+   I+   Y+H + C A I+F ++L F +C+       
Sbjct: 233 IILLCIYYFYYAFILFTVHLLLLVCIYYFYYMHLLFCCAFIIFTMHLLFLLCIYYFYCAL 292

Query: 397 VVLFCFY 377
           ++L C Y
Sbjct: 293 IILLCIY 299



 Score = 26.2 bits (55), Expect = 0.22
 Identities = 17/65 (26%), Positives = 32/65 (49%), Gaps = 1/65 (1%)
 Frame = -3

Query: 574 HLISLPNLFFFKSLI*VLLKFLIFYNI-HLQ*YLHAMQCHAIMFFVYLCF*ICLLGTV*G 398
           HL+ LP +++F S   +    L+FY +  +   ++      I+F V+L   +C+      
Sbjct: 205 HLLFLPCIYYFYSAFIIFTIHLLFYCVLIILLCIYYFYYAFILFTVHLLLLVCIYYFYYM 264

Query: 397 VVLFC 383
            +LFC
Sbjct: 265 HLLFC 269


>DQ855499-1|ABH88186.1|  124|Tribolium castaneum chemosensory
           protein 13 protein.
          Length = 124

 Score = 23.0 bits (47), Expect = 2.1
 Identities = 9/27 (33%), Positives = 17/27 (62%)
 Frame = -1

Query: 132 SIFNEKYLNNYKYLHDSVLKNRRIVFS 52
           ++ +E+Y N Y    D+ LK+ R++ S
Sbjct: 14  NVLSEEYTNQYNDELDAALKSERLMKS 40


>AM292339-1|CAL23151.2|  387|Tribolium castaneum gustatory receptor
           candidate 18 protein.
          Length = 387

 Score = 21.4 bits (43), Expect = 6.3
 Identities = 12/39 (30%), Positives = 20/39 (51%)
 Frame = +2

Query: 41  KVFILNTILLFFRTLSCKYL*LFRYFSLKMDMNNPPNQS 157
           ++F ++  LLF     C     + +  L+ D+NN  NQS
Sbjct: 345 RLFNIDNALLF---AICGSAFSYLFIMLQFDLNNKKNQS 380


>AM292359-1|CAL23171.2|  436|Tribolium castaneum gustatory receptor
           candidate 38 protein.
          Length = 436

 Score = 21.0 bits (42), Expect = 8.3
 Identities = 11/30 (36%), Positives = 15/30 (50%)
 Frame = -3

Query: 220 INKIIGTKYHIALIFSKYKPIALIWRVVHI 131
           INK    K+    I+   KPI  + R+V I
Sbjct: 47  INKSSTDKFGNGAIYEVLKPIYALMRIVGI 76


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 147,306
Number of Sequences: 336
Number of extensions: 3136
Number of successful extensions: 9
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9
length of database: 122,585
effective HSP length: 54
effective length of database: 104,441
effective search space used: 15770591
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).