SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0006
         (698 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY887136-1|AAW78361.1|  580|Tribolium castaneum vasa RNA helicas...    25   0.59 
AM292354-1|CAL23166.1|  321|Tribolium castaneum gustatory recept...    23   3.2  
EF592537-1|ABQ95983.1|  593|Tribolium castaneum beta-N-acetylglu...    21   9.7  
DQ659254-1|ABG47452.1|  431|Tribolium castaneum imaginal disc gr...    21   9.7  

>AY887136-1|AAW78361.1|  580|Tribolium castaneum vasa RNA helicase
           protein.
          Length = 580

 Score = 25.0 bits (52), Expect = 0.59
 Identities = 16/54 (29%), Positives = 25/54 (46%)
 Frame = -2

Query: 319 DVRFDVLDHYTHYRVRRVLVISFRCSKKNSSSCASLPLTEARTRLMRSMYFPTQ 158
           +V F+ L ++      R+L + F    +   S  S+P T  R  LM S  FP +
Sbjct: 304 NVSFNSLKYFVLDEADRMLDMGFLGDVEEMLSHQSMPATGERQTLMFSATFPEE 357


>AM292354-1|CAL23166.1|  321|Tribolium castaneum gustatory receptor
           candidate 33 protein.
          Length = 321

 Score = 22.6 bits (46), Expect = 3.2
 Identities = 9/21 (42%), Positives = 13/21 (61%)
 Frame = -1

Query: 89  RARPLLLQNRTKLILHGNTIQ 27
           R +  L QNR + + HG T+Q
Sbjct: 163 RLKAQLWQNRYETVAHGMTVQ 183


>EF592537-1|ABQ95983.1|  593|Tribolium castaneum
           beta-N-acetylglucosaminidase NAG2 protein.
          Length = 593

 Score = 21.0 bits (42), Expect = 9.7
 Identities = 8/24 (33%), Positives = 14/24 (58%), Gaps = 1/24 (4%)
 Frame = -3

Query: 438 NWSIISLGRSPGGAEALGRDI-VW 370
           NW ++   + P G  ALG ++ +W
Sbjct: 501 NWRVVYNNKIPTGDGALGGEVCMW 524


>DQ659254-1|ABG47452.1|  431|Tribolium castaneum imaginal disc
           growth factor 4 protein.
          Length = 431

 Score = 21.0 bits (42), Expect = 9.7
 Identities = 8/28 (28%), Positives = 15/28 (53%)
 Frame = +1

Query: 598 VAVWKATDDKAICLWEPHAVGPNGKNVF 681
           +A + A D+K +C +   A   +G+  F
Sbjct: 11  LAAYVAADNKVVCYYNSKAYFRDGQGKF 38


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 138,260
Number of Sequences: 336
Number of extensions: 2544
Number of successful extensions: 7
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 18426585
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).