SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0005
         (698 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF236856-1|AAG17563.2|  370|Tribolium castaneum Kruppel protein ...    24   1.0  
EF592178-1|ABQ95974.1|  532|Tribolium castaneum tyrosine hydroxy...    24   1.4  
AY884064-1|AAX84205.1|  683|Tribolium castaneum pro-phenol oxida...    23   3.2  
DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro...    22   4.2  
AY887136-1|AAW78361.1|  580|Tribolium castaneum vasa RNA helicas...    22   5.5  
AJ850297-1|CAH64517.1|  539|Tribolium castaneum putative esteras...    22   5.5  
AJ850295-1|CAH64515.1|  539|Tribolium castaneum putative esteras...    22   5.5  
AY531876-2|AAT08871.1|  340|Tribolium castaneum tyrosine recombi...    21   9.7  

>AF236856-1|AAG17563.2|  370|Tribolium castaneum Kruppel protein
           protein.
          Length = 370

 Score = 24.2 bits (50), Expect = 1.0
 Identities = 12/32 (37%), Positives = 16/32 (50%)
 Frame = -3

Query: 576 GEKRKLWPVLVATSQVESEASMEMRRAWRSRP 481
           G KRK W V   +    S  S E++ + R RP
Sbjct: 103 GPKRKTWKVEEDSPSPTSSVSPEVKDSSRDRP 134


>EF592178-1|ABQ95974.1|  532|Tribolium castaneum tyrosine
           hydroxylase protein.
          Length = 532

 Score = 23.8 bits (49), Expect = 1.4
 Identities = 11/33 (33%), Positives = 19/33 (57%)
 Frame = -2

Query: 292 DCVVRGRREQIGIIPIFTNPRFFKRSAELGLVA 194
           DC+     E +G +P+  +P F + S E+GL +
Sbjct: 357 DCI----HELLGHMPLLADPSFAQFSQEIGLAS 385


>AY884064-1|AAX84205.1|  683|Tribolium castaneum pro-phenol oxidase
           subunit 2 protein.
          Length = 683

 Score = 22.6 bits (46), Expect = 3.2
 Identities = 9/14 (64%), Positives = 10/14 (71%)
 Frame = -3

Query: 594 DRGSSCGEKRKLWP 553
           D GS CG K KL+P
Sbjct: 622 DAGSYCGIKDKLYP 635


>DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein.
          Length = 2700

 Score = 22.2 bits (45), Expect = 4.2
 Identities = 9/31 (29%), Positives = 19/31 (61%)
 Frame = +3

Query: 264  CSRRPRTTQSSASS*IQDGAVSHFPFGWLLS 356
            C++ P + +S+ +  +++   +  P GWLLS
Sbjct: 1954 CNKGPASDKSAFADFVKELHEAFKPKGWLLS 1984


>AY887136-1|AAW78361.1|  580|Tribolium castaneum vasa RNA helicase
           protein.
          Length = 580

 Score = 21.8 bits (44), Expect = 5.5
 Identities = 12/33 (36%), Positives = 18/33 (54%)
 Frame = -3

Query: 660 AMNEIAESR*KVG*KRAVGRLPDRGSSCGEKRK 562
           A++ + E+    G  R  GR  DRG   GE++K
Sbjct: 80  AVDFLGENNDDSGGGRGGGRDGDRGDGGGEEKK 112


>AJ850297-1|CAH64517.1|  539|Tribolium castaneum putative esterase
           protein.
          Length = 539

 Score = 21.8 bits (44), Expect = 5.5
 Identities = 13/50 (26%), Positives = 21/50 (42%)
 Frame = +3

Query: 57  GSSIQCCRALPLYQRIVP*PVS*TVWVIAVSNAPPVNRLLRHQPQVATRP 206
           G+ I+C ++ P  Q  +  P     W +  +   PV      QP + T P
Sbjct: 252 GTMIKCLKSRPARQIALTVPRYQAWWYLPFAQFGPVIDSWATQPVLPTHP 301


>AJ850295-1|CAH64515.1|  539|Tribolium castaneum putative esterase
           protein.
          Length = 539

 Score = 21.8 bits (44), Expect = 5.5
 Identities = 13/50 (26%), Positives = 21/50 (42%)
 Frame = +3

Query: 57  GSSIQCCRALPLYQRIVP*PVS*TVWVIAVSNAPPVNRLLRHQPQVATRP 206
           G+ I+C ++ P  Q  +  P     W +  +   PV      QP + T P
Sbjct: 252 GTMIKCLKSRPARQIALTVPRYQAWWYLPFAQFGPVIDSWATQPVLPTHP 301


>AY531876-2|AAT08871.1|  340|Tribolium castaneum tyrosine
           recombinase protein.
          Length = 340

 Score = 21.0 bits (42), Expect = 9.7
 Identities = 12/36 (33%), Positives = 16/36 (44%)
 Frame = -3

Query: 411 FSASCFLCVMHEMATRSIRTEANRMESATQLRLVFR 304
           F     LCV+  ++    RTE  R    T+L L  R
Sbjct: 220 FKKKPLLCVVSTLSCYLERTELLRSSGETRLFLTHR 255


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 151,984
Number of Sequences: 336
Number of extensions: 3176
Number of successful extensions: 12
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 12
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 18426585
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).