SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0001
         (485 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ415419-1|CAC94468.1|  441|Tribolium castaneum transcription fa...    24   0.84 
AY584475-1|AAS93634.1|  209|Tribolium castaneum homothorax protein.    23   1.1  
AJ518941-1|CAD57735.1|  456|Tribolium castaneum homothorax protein.    23   1.1  
EU019711-1|ABU25223.1|  534|Tribolium castaneum chitin deacetyla...    23   1.9  

>AJ415419-1|CAC94468.1|  441|Tribolium castaneum transcription
           factor protein.
          Length = 441

 Score = 23.8 bits (49), Expect = 0.84
 Identities = 13/42 (30%), Positives = 20/42 (47%)
 Frame = -3

Query: 468 TRKTKNTVRTASYNIKRPVAXISQHPNHDSEQPPELLKTAVP 343
           TR T    R + Y ++RP +     P H    PP+ ++ A P
Sbjct: 256 TRTTLKNNRASPYPMQRPKSASLSPPPH-VYNPPDHIQQATP 296


>AY584475-1|AAS93634.1|  209|Tribolium castaneum homothorax protein.
          Length = 209

 Score = 23.4 bits (48), Expect = 1.1
 Identities = 12/26 (46%), Positives = 15/26 (57%)
 Frame = -3

Query: 384 DSEQPPELLKTAVPRRGAKLNARSTS 307
           D  +PPEL  +     GA+ NA STS
Sbjct: 37  DGGKPPELTGSTNGDGGARSNADSTS 62


>AJ518941-1|CAD57735.1|  456|Tribolium castaneum homothorax protein.
          Length = 456

 Score = 23.4 bits (48), Expect = 1.1
 Identities = 12/26 (46%), Positives = 15/26 (57%)
 Frame = -3

Query: 384 DSEQPPELLKTAVPRRGAKLNARSTS 307
           D  +PPEL  +     GA+ NA STS
Sbjct: 193 DGGKPPELTGSTNGDGGARSNADSTS 218


>EU019711-1|ABU25223.1|  534|Tribolium castaneum chitin deacetylase
           1 protein.
          Length = 534

 Score = 22.6 bits (46), Expect = 1.9
 Identities = 9/26 (34%), Positives = 13/26 (50%)
 Frame = +3

Query: 345 APRSSRALEAVRCRGSDVGKCXRLAA 422
           AP+   + E   C+  D G+  RL A
Sbjct: 28  APKKEDSFEVELCKDKDAGEWFRLVA 53


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 101,487
Number of Sequences: 336
Number of extensions: 1703
Number of successful extensions: 5
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 122,585
effective HSP length: 53
effective length of database: 104,777
effective search space used: 11315916
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).