BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0245.Seq (906 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory recept... 24 1.9 AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 22 5.7 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 7.6 >AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory receptor candidate 16 protein. Length = 452 Score = 23.8 bits (49), Expect = 1.9 Identities = 10/32 (31%), Positives = 19/32 (59%) Frame = +1 Query: 76 ILKKPLKVIRNKKGRTNCKHYKIT*SILFKAD 171 ++ LK+ +N+ T CK + I ++LF A+ Sbjct: 340 VISSALKLSQNELEITACKFFSIDNALLFSAN 371 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 22.2 bits (45), Expect = 5.7 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = +2 Query: 158 YLKLIRKCNRCLHVLPQQQF*XILTKLVWT 247 Y +L+ C + + Q ILT L+WT Sbjct: 218 YSQLVFMCKKINKLYGHQLLLTILTYLIWT 247 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.8 bits (44), Expect = 7.6 Identities = 7/15 (46%), Positives = 13/15 (86%) Frame = +1 Query: 76 ILKKPLKVIRNKKGR 120 ++KK KV+R+++GR Sbjct: 2111 VIKKGWKVVRDRRGR 2125 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 178,223 Number of Sequences: 336 Number of extensions: 3256 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 25237652 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -