BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0231.Seq (683 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 21 7.1 AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 21 7.1 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 21 7.1 EF222295-1|ABN79655.1| 146|Tribolium castaneum arginine vasopre... 21 9.4 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 21.4 bits (43), Expect = 7.1 Identities = 9/33 (27%), Positives = 14/33 (42%) Frame = -1 Query: 275 SISTIWNKTARELWHGKTNDWILSCRIQIDRSP 177 S+ W ARE W+G + + R+ P Sbjct: 1011 SLVVYWKPPAREEWNGDILGYYVGYRLANSDKP 1043 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 21.4 bits (43), Expect = 7.1 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = +2 Query: 209 ESNHSFYRARVLLQFCSKLLRSIKPSFVSAILI 307 ES S Y+A QF + L RSI F +LI Sbjct: 383 ESFKSPYKASCWAQFKAVLWRSILAVFKEPLLI 415 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 21.4 bits (43), Expect = 7.1 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = +2 Query: 209 ESNHSFYRARVLLQFCSKLLRSIKPSFVSAILI 307 ES S Y+A QF + L RSI F +LI Sbjct: 383 ESFKSPYKASCWAQFKAVLWRSILAVFKEPLLI 415 >EF222295-1|ABN79655.1| 146|Tribolium castaneum arginine vasopressin-like peptide protein. Length = 146 Score = 21.0 bits (42), Expect = 9.4 Identities = 12/38 (31%), Positives = 14/38 (36%) Frame = -3 Query: 435 CFGPRRLFTHVPTTLRPQKVALFVSSRETETQLAPWRE 322 C GP P TLR Q+ F AP R+ Sbjct: 62 CCGPFGCLVGTPETLRCQREGFFHEREPCIAGSAPCRK 99 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 147,843 Number of Sequences: 336 Number of extensions: 3103 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17906060 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -