BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0219.Seq (930 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory recept... 29 0.039 EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 p... 23 3.4 AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory recept... 22 5.9 >AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory receptor candidate 40 protein. Length = 373 Score = 29.5 bits (63), Expect = 0.039 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = -2 Query: 629 TQLHNFFTKKISFVYTMKRNVGNVK*HLCLQSFGLLTVN 513 T + +FF K+ +++T N+ LCL +FGLL VN Sbjct: 177 TGVEHFFKKQFHYIFTYMPY--NIVFGLCLTTFGLLPVN 213 >EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 protein. Length = 535 Score = 23.0 bits (47), Expect = 3.4 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = -2 Query: 158 YQKSLGKFR*IAKRNKFL-GLLEEPGVNTHGCPSRE 54 YQ+ L +R + KF G E+P V T G PSR+ Sbjct: 501 YQQ-LSNYRNVDNSAKFKDGFQEQPNVVTVGNPSRK 535 >AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory receptor candidate 43 protein. Length = 353 Score = 22.2 bits (45), Expect = 5.9 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = -2 Query: 701 YNYIFTYSHIKFGVIIVHN 645 Y Y F H+ +GV+I+++ Sbjct: 116 YYYAFFGVHLAYGVVIIYS 134 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 221,082 Number of Sequences: 336 Number of extensions: 4808 Number of successful extensions: 12 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 26065116 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -