SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0113
         (659 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro...    28   0.059
DQ659253-1|ABG47451.1|  439|Tribolium castaneum imaginal disc gr...    24   1.3  
DQ659254-1|ABG47452.1|  431|Tribolium castaneum imaginal disc gr...    23   2.9  
AM292354-1|CAL23166.1|  321|Tribolium castaneum gustatory recept...    22   5.1  
EF127810-1|ABL67947.1|  311|Tribolium castaneum nicotinic acetyl...    21   6.8  
EF127809-1|ABL67946.1|  311|Tribolium castaneum nicotinic acetyl...    21   6.8  
EF127808-1|ABL67945.1|  311|Tribolium castaneum nicotinic acetyl...    21   6.8  
EF127807-1|ABL67944.1|  311|Tribolium castaneum nicotinic acetyl...    21   6.8  
EF127806-1|ABL67943.1|  311|Tribolium castaneum nicotinic acetyl...    21   6.8  
AJ005083-1|CAB65469.1|  585|Tribolium castaneum signal receptor ...    21   6.8  

>DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10
           protein.
          Length = 2700

 Score = 28.3 bits (60), Expect = 0.059
 Identities = 9/21 (42%), Positives = 11/21 (52%)
 Frame = -2

Query: 622 RNNFSIRYWSWNYRGCWHQTC 560
           R+NF   +  WNY  CW   C
Sbjct: 746 RHNFKGLHLDWNYPVCWQSNC 766



 Score = 23.4 bits (48), Expect = 1.7
 Identities = 8/25 (32%), Positives = 9/25 (36%)
 Frame = -2

Query: 634  ELFNRNNFSIRYWSWNYRGCWHQTC 560
            +    NNF      W Y  CW   C
Sbjct: 1930 DFIETNNFDGLDLDWEYPKCWQVDC 1954


>DQ659253-1|ABG47451.1|  439|Tribolium castaneum imaginal disc
           growth factor 2 protein.
          Length = 439

 Score = 23.8 bits (49), Expect = 1.3
 Identities = 9/27 (33%), Positives = 14/27 (51%)
 Frame = +1

Query: 418 TSKEGSRRANYPLPAREVVTKNNDTGL 498
           T     + A+YP P  E+V + ND  +
Sbjct: 250 TPARNPKEADYPSPLYELVDRRNDENI 276


>DQ659254-1|ABG47452.1|  431|Tribolium castaneum imaginal disc
           growth factor 4 protein.
          Length = 431

 Score = 22.6 bits (46), Expect = 2.9
 Identities = 8/24 (33%), Positives = 13/24 (54%)
 Frame = +1

Query: 418 TSKEGSRRANYPLPAREVVTKNND 489
           T K   + A+YP P  E++ +  D
Sbjct: 242 TPKRNPKEADYPAPLYELIDRKYD 265


>AM292354-1|CAL23166.1|  321|Tribolium castaneum gustatory receptor
           candidate 33 protein.
          Length = 321

 Score = 21.8 bits (44), Expect = 5.1
 Identities = 5/16 (31%), Positives = 9/16 (56%)
 Frame = -2

Query: 613 FSIRYWSWNYRGCWHQ 566
           +++ YW   Y   WH+
Sbjct: 117 YAVYYWRQQYEDFWHR 132


>EF127810-1|ABL67947.1|  311|Tribolium castaneum nicotinic
           acetylcholine receptor subunitalpha 6 transcript variant
           5 protein.
          Length = 311

 Score = 21.4 bits (43), Expect = 6.8
 Identities = 10/37 (27%), Positives = 21/37 (56%)
 Frame = +3

Query: 12  LYACLKD*AMHVSVQAVLRRYREWLNISVLVP*ILLS 122
           +YAC  +  + V+    +RR   +   +++VP +L+S
Sbjct: 190 VYACCPEPYVDVTFTIKIRRRTLYYFFNLIVPCVLIS 226


>EF127809-1|ABL67946.1|  311|Tribolium castaneum nicotinic
           acetylcholine receptor subunitalpha 6 transcript variant
           4 protein.
          Length = 311

 Score = 21.4 bits (43), Expect = 6.8
 Identities = 10/37 (27%), Positives = 21/37 (56%)
 Frame = +3

Query: 12  LYACLKD*AMHVSVQAVLRRYREWLNISVLVP*ILLS 122
           +YAC  +  + V+    +RR   +   +++VP +L+S
Sbjct: 190 VYACCPEPYVDVTFTIKIRRRTLYYFFNLIVPCVLIS 226


>EF127808-1|ABL67945.1|  311|Tribolium castaneum nicotinic
           acetylcholine receptor subunitalpha 6 transcript variant
           3 protein.
          Length = 311

 Score = 21.4 bits (43), Expect = 6.8
 Identities = 10/37 (27%), Positives = 21/37 (56%)
 Frame = +3

Query: 12  LYACLKD*AMHVSVQAVLRRYREWLNISVLVP*ILLS 122
           +YAC  +  + V+    +RR   +   +++VP +L+S
Sbjct: 190 VYACCPEPYVDVTFTIKIRRRTLYYFFNLIVPCVLIS 226


>EF127807-1|ABL67944.1|  311|Tribolium castaneum nicotinic
           acetylcholine receptor subunitalpha 6 transcript variant
           2 protein.
          Length = 311

 Score = 21.4 bits (43), Expect = 6.8
 Identities = 10/37 (27%), Positives = 21/37 (56%)
 Frame = +3

Query: 12  LYACLKD*AMHVSVQAVLRRYREWLNISVLVP*ILLS 122
           +YAC  +  + V+    +RR   +   +++VP +L+S
Sbjct: 190 VYACCPEPYVDVTFTIKIRRRTLYYFFNLIVPCVLIS 226


>EF127806-1|ABL67943.1|  311|Tribolium castaneum nicotinic
           acetylcholine receptor subunitalpha 6 transcript variant
           1 protein.
          Length = 311

 Score = 21.4 bits (43), Expect = 6.8
 Identities = 10/37 (27%), Positives = 21/37 (56%)
 Frame = +3

Query: 12  LYACLKD*AMHVSVQAVLRRYREWLNISVLVP*ILLS 122
           +YAC  +  + V+    +RR   +   +++VP +L+S
Sbjct: 190 VYACCPEPYVDVTFTIKIRRRTLYYFFNLIVPCVLIS 226


>AJ005083-1|CAB65469.1|  585|Tribolium castaneum signal receptor
           protein protein.
          Length = 585

 Score = 21.4 bits (43), Expect = 6.8
 Identities = 8/20 (40%), Positives = 13/20 (65%)
 Frame = -1

Query: 311 HLKDASPVLDHAICKSYPDH 252
           +L D+SP L+ A C+ +  H
Sbjct: 63  NLCDSSPCLNGATCQDHTTH 82


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 150,905
Number of Sequences: 336
Number of extensions: 3324
Number of successful extensions: 15
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 11
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 15
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 17073220
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).