SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0109
         (498 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292378-1|CAL23190.2|  387|Tribolium castaneum gustatory recept...    22   2.7  
AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr...    21   4.7  

>AM292378-1|CAL23190.2|  387|Tribolium castaneum gustatory receptor
           candidate 57 protein.
          Length = 387

 Score = 22.2 bits (45), Expect = 2.7
 Identities = 12/36 (33%), Positives = 14/36 (38%)
 Frame = -3

Query: 286 WLRPPRHSASTRRLFSLRFGKKLRVFIIAYFKCFLH 179
           WL PP    +T    SLRF     V I      + H
Sbjct: 7   WLTPPHSLGNTVTPVSLRFKLYTIVHIFIIIALYAH 42


>AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like
           protein protein.
          Length = 1156

 Score = 21.4 bits (43), Expect = 4.7
 Identities = 9/15 (60%), Positives = 10/15 (66%)
 Frame = -2

Query: 332 TNGSLRPFGSLGTKS 288
           TNG  +P GSLG  S
Sbjct: 949 TNGDRKPGGSLGALS 963


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 120,702
Number of Sequences: 336
Number of extensions: 2640
Number of successful extensions: 6
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 122,585
effective HSP length: 53
effective length of database: 104,777
effective search space used: 11735024
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).