SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0106
         (711 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM295015-1|CAL25730.1|  549|Tribolium castaneum ecdysone recepto...    23   1.9  
AY800247-1|AAV66724.1|  790|Tribolium castaneum pangolin protein.      23   2.5  
AY800246-1|AAV66723.1|  682|Tribolium castaneum pangolin protein.      23   2.5  
EF117815-1|ABO38438.1|  535|Tribolium castaneum cryptochrome 2 p...    23   3.2  
DQ211693-1|ABB16909.1|  314|Tribolium castaneum dorsocross protein.    22   5.7  
AJ223614-1|CAA11490.1|  301|Tribolium castaneum orthodenticle-2 ...    22   5.7  
AF227923-1|AAF36721.1|  351|Tribolium castaneum abdominal-B prot...    22   5.7  
EU008544-1|ABS31131.1|  493|Tribolium castaneum cytochrome P450 ...    21   7.5  
AF217810-1|AAF71998.1|  431|Tribolium castaneum fork head orthol...    21   7.5  
DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad...    21   9.9  

>AM295015-1|CAL25730.1|  549|Tribolium castaneum ecdysone receptor
           (isoform A) protein.
          Length = 549

 Score = 23.4 bits (48), Expect = 1.9
 Identities = 13/35 (37%), Positives = 19/35 (54%), Gaps = 1/35 (2%)
 Frame = -2

Query: 572 LNGGRTESCRSRTKRNRHDLRQED-PRKAGERGSG 471
           LNG   +SC S+ K+     +QE+     G+R SG
Sbjct: 163 LNGYSADSCDSKKKKGPTPRQQEELCLVCGDRASG 197


>AY800247-1|AAV66724.1|  790|Tribolium castaneum pangolin protein.
          Length = 790

 Score = 23.0 bits (47), Expect = 2.5
 Identities = 7/15 (46%), Positives = 10/15 (66%)
 Frame = -2

Query: 146 NFQGPQRVSGHRRKC 102
           NF GP R++   R+C
Sbjct: 601 NFHGPHRLAARSRRC 615


>AY800246-1|AAV66723.1|  682|Tribolium castaneum pangolin protein.
          Length = 682

 Score = 23.0 bits (47), Expect = 2.5
 Identities = 7/15 (46%), Positives = 10/15 (66%)
 Frame = -2

Query: 146 NFQGPQRVSGHRRKC 102
           NF GP R++   R+C
Sbjct: 493 NFHGPHRLAARSRRC 507


>EF117815-1|ABO38438.1|  535|Tribolium castaneum cryptochrome 2
           protein.
          Length = 535

 Score = 22.6 bits (46), Expect = 3.2
 Identities = 9/20 (45%), Positives = 12/20 (60%)
 Frame = -3

Query: 64  RIPWNSNAQAEKKTLPGPLG 5
           +IPW+ NA+A  K   G  G
Sbjct: 330 QIPWDKNAEALAKWANGQTG 349


>DQ211693-1|ABB16909.1|  314|Tribolium castaneum dorsocross protein.
          Length = 314

 Score = 21.8 bits (44), Expect = 5.7
 Identities = 11/40 (27%), Positives = 19/40 (47%), Gaps = 5/40 (12%)
 Frame = -1

Query: 159 HPSPEFSRSAESIRTPPQMRCSSRSE-----PYLPSIGFH 55
           HP    S+ + +   PPQ+  + R E     P +P + F+
Sbjct: 217 HPDSPNSKKSATPSPPPQLEVNERKENLTCQPAVPYVPFY 256


>AJ223614-1|CAA11490.1|  301|Tribolium castaneum orthodenticle-2
           protein protein.
          Length = 301

 Score = 21.8 bits (44), Expect = 5.7
 Identities = 8/15 (53%), Positives = 10/15 (66%)
 Frame = -1

Query: 348 PGTGPHPLPVQTRHA 304
           PG G H LPV + H+
Sbjct: 42  PGLGLHGLPVDSLHS 56


>AF227923-1|AAF36721.1|  351|Tribolium castaneum abdominal-B
           protein.
          Length = 351

 Score = 21.8 bits (44), Expect = 5.7
 Identities = 7/25 (28%), Positives = 12/25 (48%)
 Frame = -1

Query: 192 YGYEPARHLHVHPSPEFSRSAESIR 118
           + Y P  H   +P+P +   A+  R
Sbjct: 76  WNYSPDNHFEQYPNPTYYNLADPAR 100


>EU008544-1|ABS31131.1|  493|Tribolium castaneum cytochrome P450
           protein.
          Length = 493

 Score = 21.4 bits (43), Expect = 7.5
 Identities = 9/24 (37%), Positives = 13/24 (54%)
 Frame = +1

Query: 418 LYIFNMTLAKIVLRFGLDPDPRSP 489
           L +  + LA +V  F  DP  R+P
Sbjct: 444 LLVSKVALASVVKDFVFDPTERTP 467


>AF217810-1|AAF71998.1|  431|Tribolium castaneum fork head
           orthologue protein.
          Length = 431

 Score = 21.4 bits (43), Expect = 7.5
 Identities = 8/19 (42%), Positives = 11/19 (57%)
 Frame = -1

Query: 333 HPLPVQTRHAPVLRANPYS 277
           HPL + + H  +L  NP S
Sbjct: 335 HPLSLSSDHQAMLHHNPMS 353


>DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome
           adhesion molecule splicevariant 3.12.3.1 protein.
          Length = 1639

 Score = 21.0 bits (42), Expect = 9.9
 Identities = 8/25 (32%), Positives = 12/25 (48%)
 Frame = +2

Query: 134 DLENSGEGCTWRCRAGSYPYPQQVS 208
           D  N G+G + +C      YP  +S
Sbjct: 613 DSINEGDGVSVQCTVSKGDYPLNIS 637


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 178,358
Number of Sequences: 336
Number of extensions: 4120
Number of successful extensions: 11
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 11
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 18843005
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).