SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0100
         (644 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY531877-1|AAT08872.1|  247|Tribolium castaneum ORF1p protein.         26   0.23 
EF117815-1|ABO38438.1|  535|Tribolium castaneum cryptochrome 2 p...    23   2.8  
AM292360-1|CAL23172.2|  427|Tribolium castaneum gustatory recept...    22   3.8  
AM292331-1|CAL23143.2|  437|Tribolium castaneum gustatory recept...    22   3.8  
DQ414248-1|ABD63010.2|  311|Tribolium castaneum sloppy-paired pr...    21   6.6  
AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr...    21   8.7  

>AY531877-1|AAT08872.1|  247|Tribolium castaneum ORF1p protein.
          Length = 247

 Score = 26.2 bits (55), Expect = 0.23
 Identities = 13/45 (28%), Positives = 20/45 (44%)
 Frame = -1

Query: 341 PRTGSRGSFKRRRAFPPRHHSARLERNTVARRYYRPRTASAQPSK 207
           PR  S+   +  ++   R      E  T    YYRPRT+  +P +
Sbjct: 200 PRQYSQSRGRHNQSRSKRQPKTGREDQTRRNPYYRPRTSRTEPPR 244


>EF117815-1|ABO38438.1|  535|Tribolium castaneum cryptochrome 2
           protein.
          Length = 535

 Score = 22.6 bits (46), Expect = 2.8
 Identities = 8/19 (42%), Positives = 10/19 (52%)
 Frame = +2

Query: 170 SSLKNHYFHCFITYSVGRK 226
           SS    +FHC+     GRK
Sbjct: 416 SSFFQQFFHCYCPIKFGRK 434


>AM292360-1|CAL23172.2|  427|Tribolium castaneum gustatory receptor
           candidate 39 protein.
          Length = 427

 Score = 22.2 bits (45), Expect = 3.8
 Identities = 7/18 (38%), Positives = 11/18 (61%)
 Frame = -1

Query: 395 ALFFDRCTAPVKLPAWQC 342
           +L+F  CTA  ++  W C
Sbjct: 223 SLWFINCTAKGRVAVWMC 240


>AM292331-1|CAL23143.2|  437|Tribolium castaneum gustatory receptor
           candidate 10 protein.
          Length = 437

 Score = 22.2 bits (45), Expect = 3.8
 Identities = 7/18 (38%), Positives = 11/18 (61%)
 Frame = -1

Query: 395 ALFFDRCTAPVKLPAWQC 342
           +L+F  CTA  ++  W C
Sbjct: 223 SLWFINCTAKGRVAVWMC 240


>DQ414248-1|ABD63010.2|  311|Tribolium castaneum sloppy-paired
           protein.
          Length = 311

 Score = 21.4 bits (43), Expect = 6.6
 Identities = 9/33 (27%), Positives = 14/33 (42%)
 Frame = -1

Query: 332 GSRGSFKRRRAFPPRHHSARLERNTVARRYYRP 234
           G+ G  +RR     R   A  +R      +Y+P
Sbjct: 170 GTTGKLRRRSTAASRSRLAAFKRTIALGAFYQP 202


>AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein
            protein.
          Length = 1156

 Score = 21.0 bits (42), Expect = 8.7
 Identities = 11/40 (27%), Positives = 15/40 (37%)
 Frame = +1

Query: 313  LKLPRDPVRGHCQAGSLTGAVHLSKNNAGVLRPAQRGQKP 432
            L  PR P   H  +     A   S + +G  R     +KP
Sbjct: 916  LTSPRQPAETHAGSPCRNSASPASSDRSGTPRSTNGDRKP 955


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 152,211
Number of Sequences: 336
Number of extensions: 3394
Number of successful extensions: 6
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 16552695
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).