SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0097
         (620 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept...    24   1.2  
EF222292-1|ABN79652.1|  354|Tribolium castaneum cardioactive pep...    23   2.7  
DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro...    22   3.6  
AM292378-1|CAL23190.2|  387|Tribolium castaneum gustatory recept...    22   3.6  
AY887136-1|AAW78361.1|  580|Tribolium castaneum vasa RNA helicas...    22   4.8  
AJ518940-1|CAD57734.1|  361|Tribolium castaneum extradenticle pr...    22   4.8  
AY920544-1|AAX62142.1|  463|Tribolium castaneum cytochrome P450 ...    21   6.3  
AY316682-1|AAQ83696.1|  456|Tribolium castaneum Sp-like zinc fin...    21   8.3  
AM292372-1|CAL23184.2|  771|Tribolium castaneum gustatory recept...    21   8.3  
AM292361-1|CAL23173.2|  373|Tribolium castaneum gustatory recept...    21   8.3  

>AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor
           candidate 46 protein.
          Length = 1451

 Score = 23.8 bits (49), Expect = 1.2
 Identities = 11/30 (36%), Positives = 17/30 (56%)
 Frame = +1

Query: 163 LTVDCATSRKGKTRRFLSTLHHNSPQLNSR 252
           LT +CAT  +      + TLHH+  +L +R
Sbjct: 562 LTKNCATKAQSVVLGRICTLHHHLSKLVTR 591


>EF222292-1|ABN79652.1|  354|Tribolium castaneum cardioactive
           peptide receptor 2 protein.
          Length = 354

 Score = 22.6 bits (46), Expect = 2.7
 Identities = 13/41 (31%), Positives = 22/41 (53%)
 Frame = +1

Query: 13  ACTTWLSTLRCYSLHSSAVV*LNSTSSPQGYAGKWTPARVL 135
           A  T+ ST   Y L + ++   ++ + P  ++G W  ARVL
Sbjct: 127 AVVTYSST---YVLVALSIDRYDAITHPMNFSGSWKRARVL 164


>DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10
           protein.
          Length = 2700

 Score = 22.2 bits (45), Expect = 3.6
 Identities = 10/26 (38%), Positives = 14/26 (53%)
 Frame = -2

Query: 178 HSRLLTQGSIRTSFTVHALASTSRHS 101
           +SRL+  GS R  F V  +    RH+
Sbjct: 723 YSRLVGDGSARRRFVVAVVGFLRRHN 748


>AM292378-1|CAL23190.2|  387|Tribolium castaneum gustatory receptor
           candidate 57 protein.
          Length = 387

 Score = 22.2 bits (45), Expect = 3.6
 Identities = 10/23 (43%), Positives = 13/23 (56%)
 Frame = -1

Query: 446 LSLSSFQSFHLNSKFPVGSFFPI 378
           L+L + QS    SKF    FFP+
Sbjct: 341 LALLAQQSTSRTSKFSAAGFFPV 363


>AY887136-1|AAW78361.1|  580|Tribolium castaneum vasa RNA helicase
           protein.
          Length = 580

 Score = 21.8 bits (44), Expect = 4.8
 Identities = 8/21 (38%), Positives = 12/21 (57%)
 Frame = +1

Query: 169 VDCATSRKGKTRRFLSTLHHN 231
           + CA +  GKT  F+  + HN
Sbjct: 199 MSCAQTGSGKTAAFMLPIIHN 219


>AJ518940-1|CAD57734.1|  361|Tribolium castaneum extradenticle
           protein.
          Length = 361

 Score = 21.8 bits (44), Expect = 4.8
 Identities = 11/34 (32%), Positives = 18/34 (52%)
 Frame = +3

Query: 90  VTTRLCREVDASACTVNEVRIDPCVNSRLCHLKK 191
           +T +   E  A   T+N  R+ P + S LC +K+
Sbjct: 50  ITDQSLDEAQARKHTLNCHRMKPALFSVLCEIKE 83


>AY920544-1|AAX62142.1|  463|Tribolium castaneum cytochrome P450
           monooxygenase protein.
          Length = 463

 Score = 21.4 bits (43), Expect = 6.3
 Identities = 9/40 (22%), Positives = 22/40 (55%)
 Frame = +3

Query: 132 TVNEVRIDPCVNSRLCHLKKGKNAKVSFDFTPQFSTTKLK 251
           +V+    +P ++  L +L   K  ++    +P F+++K+K
Sbjct: 62  SVSNTNTEPLLSEALTNLPGEKWKEMRATLSPAFTSSKIK 101


>AY316682-1|AAQ83696.1|  456|Tribolium castaneum Sp-like zinc finger
           protein protein.
          Length = 456

 Score = 21.0 bits (42), Expect = 8.3
 Identities = 8/17 (47%), Positives = 9/17 (52%)
 Frame = -1

Query: 287 EFQRHSSTQRGGLEFSC 237
           E QRH  T  G   F+C
Sbjct: 361 ELQRHLRTHTGEKRFAC 377


>AM292372-1|CAL23184.2|  771|Tribolium castaneum gustatory receptor
           candidate 51 protein.
          Length = 771

 Score = 21.0 bits (42), Expect = 8.3
 Identities = 7/17 (41%), Positives = 10/17 (58%)
 Frame = -3

Query: 534 TQRVYYAIWSSCFLCLL 484
           T + YY   + C+ CLL
Sbjct: 35  TNQKYYPSLAKCYACLL 51


>AM292361-1|CAL23173.2|  373|Tribolium castaneum gustatory receptor
           candidate 40 protein.
          Length = 373

 Score = 21.0 bits (42), Expect = 8.3
 Identities = 8/22 (36%), Positives = 11/22 (50%)
 Frame = -1

Query: 560 VSHFLCRYIHSVFTMQSGAVVF 495
           V HF  +  H +FT     +VF
Sbjct: 179 VEHFFKKQFHYIFTYMPYNIVF 200


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 144,305
Number of Sequences: 336
Number of extensions: 3042
Number of successful extensions: 11
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 11
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11
length of database: 122,585
effective HSP length: 54
effective length of database: 104,441
effective search space used: 15875032
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).