SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0085
         (691 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EU019711-1|ABU25223.1|  534|Tribolium castaneum chitin deacetyla...    23   1.8  
AY873916-1|AAW67572.1|  377|Tribolium castaneum chitinase 6 prot...    23   3.1  
AF322227-1|AAK01654.1|  782|Tribolium castaneum cell surface pro...    23   3.1  
DQ342040-1|ABC69932.1|  822|Tribolium castaneum STIP protein.          22   5.4  
AM292341-1|CAL23153.2|  393|Tribolium castaneum gustatory recept...    21   7.2  

>EU019711-1|ABU25223.1|  534|Tribolium castaneum chitin deacetylase
           1 protein.
          Length = 534

 Score = 23.4 bits (48), Expect = 1.8
 Identities = 13/44 (29%), Positives = 22/44 (50%)
 Frame = +1

Query: 511 RLLAPDLPSNCSSLKYLKCTHSDYEARKSPVSLFFVTTSPCREW 642
           RL+A +   NC  +  ++CT S  +A + P  L+F       +W
Sbjct: 50  RLVAGE-GDNCRDV--IQCTSSGLQAIRCPAGLYFDIDKQTCDW 90


>AY873916-1|AAW67572.1|  377|Tribolium castaneum chitinase 6
           protein.
          Length = 377

 Score = 22.6 bits (46), Expect = 3.1
 Identities = 12/40 (30%), Positives = 15/40 (37%)
 Frame = +3

Query: 408 SITADACTDSAAHKCNYELFNRNNFSIRYWSWNYAAAGTR 527
           ++ ADA   +   K   E F   NF      W Y   G R
Sbjct: 111 AVAADATKRATMAKSALEFFETYNFDGLDVDWEYPLEGDR 150


>AF322227-1|AAK01654.1|  782|Tribolium castaneum cell surface
           protein chaoptin protein.
          Length = 782

 Score = 22.6 bits (46), Expect = 3.1
 Identities = 11/40 (27%), Positives = 20/40 (50%)
 Frame = +1

Query: 469 TATILVYAIGAGITRLLAPDLPSNCSSLKYLKCTHSDYEA 588
           T  +L  ++       +A ++  N SSL+YL   ++D  A
Sbjct: 465 TPNLLSLSLAFNSLPTVALEVAGNISSLRYLNLDYNDLSA 504


>DQ342040-1|ABC69932.1|  822|Tribolium castaneum STIP protein.
          Length = 822

 Score = 21.8 bits (44), Expect = 5.4
 Identities = 9/29 (31%), Positives = 17/29 (58%)
 Frame = -2

Query: 291 LNKLECSKRAKNVLEYFVHGIIEYDLGSI 205
           L+ L+ ++  KN+LE      + Y+LG +
Sbjct: 387 LSLLQVAQIFKNLLENHYEEFVRYELGEL 415


>AM292341-1|CAL23153.2|  393|Tribolium castaneum gustatory receptor
           candidate 20 protein.
          Length = 393

 Score = 21.4 bits (43), Expect = 7.2
 Identities = 8/13 (61%), Positives = 10/13 (76%)
 Frame = -3

Query: 278 SAQSGLKMCLNIS 240
           S+Q G K CLN+S
Sbjct: 32  SSQKGQKTCLNLS 44


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 155,726
Number of Sequences: 336
Number of extensions: 3286
Number of successful extensions: 6
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 18114270
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).