SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0038
         (703 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr...    25   0.45 
AY316682-1|AAQ83696.1|  456|Tribolium castaneum Sp-like zinc fin...    24   1.4  
X97819-1|CAA66399.1|  251|Tribolium castaneum ZEN Tc protein.          22   4.2  
AY884062-1|AAX84203.1|  712|Tribolium castaneum laccase 2B protein.    22   4.2  
AY884061-1|AAX84202.1|  717|Tribolium castaneum laccase 2A protein.    22   4.2  
AF321227-4|AAK16424.1|  246|Tribolium castaneum Zen protein.           22   4.2  
EF222293-1|ABN79653.1|  434|Tribolium castaneum ecdysis triggeri...    21   7.4  
AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ...    21   7.4  
AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ...    21   7.4  

>AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like
           protein protein.
          Length = 1156

 Score = 25.4 bits (53), Expect = 0.45
 Identities = 27/94 (28%), Positives = 43/94 (45%), Gaps = 9/94 (9%)
 Frame = -3

Query: 701 AILTCKSIVGTGYRAKD*SNHLVAGS------VRSFPQDSWRRYKI---LKQSHPVKRMI 549
           A+LTCK         K+ SNH+V  S      +RS  +   RR +     K+S PV++++
Sbjct: 546 AVLTCKVCDQAFSSLKELSNHMVKNSHYKEHIMRSITESGGRRRQTREKRKKSLPVRKLL 605

Query: 548 RGIGAETTSTYSQI*MGENSGLLER*SRRSDDGA 447
                E      +   G++S LL++   R   GA
Sbjct: 606 -----ELERAQHEFKNGDSSSLLDK--MRDSSGA 632


>AY316682-1|AAQ83696.1|  456|Tribolium castaneum Sp-like zinc finger
           protein protein.
          Length = 456

 Score = 23.8 bits (49), Expect = 1.4
 Identities = 8/28 (28%), Positives = 13/28 (46%)
 Frame = +3

Query: 228 IGKTLQRHPFQGWLLRQVSRCTLLSGFR 311
           +G    RHP++ W    +S  T   G +
Sbjct: 153 LGSVYSRHPYESWPFNTMSGATHHGGIK 180


>X97819-1|CAA66399.1|  251|Tribolium castaneum ZEN Tc protein.
          Length = 251

 Score = 22.2 bits (45), Expect = 4.2
 Identities = 8/15 (53%), Positives = 11/15 (73%)
 Frame = +1

Query: 88  PRSAPTEAPSGLTPR 132
           PRS+P E  S L+P+
Sbjct: 154 PRSSPAETASSLSPQ 168


>AY884062-1|AAX84203.1|  712|Tribolium castaneum laccase 2B protein.
          Length = 712

 Score = 22.2 bits (45), Expect = 4.2
 Identities = 10/24 (41%), Positives = 12/24 (50%)
 Frame = -3

Query: 329 GRWPWKSESAKECATTHLPKQPAL 258
           GR  WK    +  AT  L K P+L
Sbjct: 79  GRKAWKHLDFRNSATAELLKNPSL 102


>AY884061-1|AAX84202.1|  717|Tribolium castaneum laccase 2A protein.
          Length = 717

 Score = 22.2 bits (45), Expect = 4.2
 Identities = 10/24 (41%), Positives = 12/24 (50%)
 Frame = -3

Query: 329 GRWPWKSESAKECATTHLPKQPAL 258
           GR  WK    +  AT  L K P+L
Sbjct: 79  GRKAWKHLDFRNSATAELLKNPSL 102


>AF321227-4|AAK16424.1|  246|Tribolium castaneum Zen protein.
          Length = 246

 Score = 22.2 bits (45), Expect = 4.2
 Identities = 8/15 (53%), Positives = 11/15 (73%)
 Frame = +1

Query: 88  PRSAPTEAPSGLTPR 132
           PRS+P E  S L+P+
Sbjct: 145 PRSSPAETASSLSPQ 159


>EF222293-1|ABN79653.1|  434|Tribolium castaneum ecdysis triggering
           hormone receptorisoform A protein.
          Length = 434

 Score = 21.4 bits (43), Expect = 7.4
 Identities = 9/16 (56%), Positives = 10/16 (62%)
 Frame = -2

Query: 288 NDSPAEATSPEMDGAE 241
           NDSP    S E+DG E
Sbjct: 418 NDSPESNRSNEIDGPE 433


>AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase
           protein.
          Length = 1464

 Score = 21.4 bits (43), Expect = 7.4
 Identities = 8/20 (40%), Positives = 13/20 (65%)
 Frame = -3

Query: 278 LPKQPALKWMALKRFAYTLP 219
           LP+   ++W+ L  FAY +P
Sbjct: 113 LPEVERVQWIWLLIFAYLIP 132


>AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase
           CHS2 protein.
          Length = 1464

 Score = 21.4 bits (43), Expect = 7.4
 Identities = 8/20 (40%), Positives = 13/20 (65%)
 Frame = -3

Query: 278 LPKQPALKWMALKRFAYTLP 219
           LP+   ++W+ L  FAY +P
Sbjct: 113 LPEVERVQWIWLLIFAYLIP 132


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 168,851
Number of Sequences: 336
Number of extensions: 3845
Number of successful extensions: 12
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 11
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 18530690
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).