SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0032
         (636 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292365-1|CAL23177.1|  313|Tribolium castaneum gustatory recept...    23   2.1  
AM292325-1|CAL23137.2|  309|Tribolium castaneum gustatory recept...    23   2.1  
AJ973445-1|CAJ01492.1|  127|Tribolium castaneum hypothetical pro...    22   3.7  
DQ855498-1|ABH88185.1|  127|Tribolium castaneum chemosensory pro...    22   4.9  
U14732-1|AAC46491.1|  322|Tribolium castaneum fushi-tarazu protein.    21   6.5  
AY043292-2|AAK96032.1|  290|Tribolium castaneum homeodomain tran...    21   6.5  
AF321227-1|AAK16421.1|  290|Tribolium castaneum Ftz protein.           21   6.5  
EF592537-1|ABQ95983.1|  593|Tribolium castaneum beta-N-acetylglu...    21   8.6  
DQ490059-1|ABF22614.1|  947|Tribolium castaneum short gastrulati...    21   8.6  
AM292352-1|CAL23164.1|  250|Tribolium castaneum gustatory recept...    21   8.6  

>AM292365-1|CAL23177.1|  313|Tribolium castaneum gustatory receptor
           candidate 44 protein.
          Length = 313

 Score = 23.0 bits (47), Expect = 2.1
 Identities = 15/34 (44%), Positives = 17/34 (50%), Gaps = 2/34 (5%)
 Frame = +1

Query: 25  GSRPAPR--STPLCACGGTAALDAVCLIPLIFLT 120
           G R  PR  STPL     T  L   C + L+FLT
Sbjct: 54  GLRDCPRKYSTPLAKI--TTILQRYCSVLLVFLT 85


>AM292325-1|CAL23137.2|  309|Tribolium castaneum gustatory receptor
           candidate 4 protein.
          Length = 309

 Score = 23.0 bits (47), Expect = 2.1
 Identities = 15/34 (44%), Positives = 17/34 (50%), Gaps = 2/34 (5%)
 Frame = +1

Query: 25  GSRPAPR--STPLCACGGTAALDAVCLIPLIFLT 120
           G R  PR  STPL     T  L   C + L+FLT
Sbjct: 50  GLRDCPRKYSTPLAKI--TTILQRYCSVLLVFLT 81


>AJ973445-1|CAJ01492.1|  127|Tribolium castaneum hypothetical
           protein protein.
          Length = 127

 Score = 22.2 bits (45), Expect = 3.7
 Identities = 12/30 (40%), Positives = 14/30 (46%)
 Frame = -3

Query: 223 EDGGRTPFQRLQFLVRDWSFPYEAPYGADG 134
           +DG RT  + L    RDW    EA Y   G
Sbjct: 81  QDGSRTIIRYLIKNKRDWWNELEAKYDPTG 110


>DQ855498-1|ABH88185.1|  127|Tribolium castaneum chemosensory
           protein 12 protein.
          Length = 127

 Score = 21.8 bits (44), Expect = 4.9
 Identities = 12/30 (40%), Positives = 14/30 (46%)
 Frame = -3

Query: 223 EDGGRTPFQRLQFLVRDWSFPYEAPYGADG 134
           +DG RT  + L    RDW    EA Y   G
Sbjct: 81  KDGSRTIIRYLIKNKRDWWNELEAKYDPTG 110


>U14732-1|AAC46491.1|  322|Tribolium castaneum fushi-tarazu protein.
          Length = 322

 Score = 21.4 bits (43), Expect = 6.5
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = +2

Query: 470 SLSEPPRQLKPW 505
           S+SEPP    PW
Sbjct: 160 SVSEPPANFYPW 171


>AY043292-2|AAK96032.1|  290|Tribolium castaneum homeodomain
           transcription factor Fushitarazu protein.
          Length = 290

 Score = 21.4 bits (43), Expect = 6.5
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = +2

Query: 470 SLSEPPRQLKPW 505
           S+SEPP    PW
Sbjct: 160 SVSEPPANFYPW 171


>AF321227-1|AAK16421.1|  290|Tribolium castaneum Ftz protein.
          Length = 290

 Score = 21.4 bits (43), Expect = 6.5
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = +2

Query: 470 SLSEPPRQLKPW 505
           S+SEPP    PW
Sbjct: 160 SVSEPPANFYPW 171


>EF592537-1|ABQ95983.1|  593|Tribolium castaneum
           beta-N-acetylglucosaminidase NAG2 protein.
          Length = 593

 Score = 21.0 bits (42), Expect = 8.6
 Identities = 11/34 (32%), Positives = 17/34 (50%)
 Frame = +2

Query: 266 RSSSWMFCERLYI*TDDSIVDRANTVAQSRTVDS 367
           R  SW+F E +      +  ++ NTV  + TV S
Sbjct: 109 REISWIFLETVANENTTNCPEQKNTVTVTFTVQS 142


>DQ490059-1|ABF22614.1|  947|Tribolium castaneum short gastrulation
           protein.
          Length = 947

 Score = 21.0 bits (42), Expect = 8.6
 Identities = 9/24 (37%), Positives = 12/24 (50%), Gaps = 2/24 (8%)
 Frame = +2

Query: 236 TVLCEQ*R--CWRSSSWMFCERLY 301
           T  CE  +  CWR      CE+L+
Sbjct: 875 TCKCENGKPTCWRECDKATCEKLF 898


>AM292352-1|CAL23164.1|  250|Tribolium castaneum gustatory receptor
           candidate 31 protein.
          Length = 250

 Score = 21.0 bits (42), Expect = 8.6
 Identities = 7/24 (29%), Positives = 14/24 (58%)
 Frame = +1

Query: 43  RSTPLCACGGTAALDAVCLIPLIF 114
           R   +C CG +   ++  ++PL+F
Sbjct: 207 RLISVCLCGASVHSESSKVLPLLF 230


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 133,224
Number of Sequences: 336
Number of extensions: 2593
Number of successful extensions: 10
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 10
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 10
length of database: 122,585
effective HSP length: 54
effective length of database: 104,441
effective search space used: 16397237
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).