SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0014
         (389 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY531877-1|AAT08872.1|  247|Tribolium castaneum ORF1p protein.         23   1.1  
AM292372-1|CAL23184.2|  771|Tribolium castaneum gustatory recept...    21   3.3  
EF592537-1|ABQ95983.1|  593|Tribolium castaneum beta-N-acetylglu...    21   5.7  
DQ659252-1|ABG47450.1|  377|Tribolium castaneum chitinase 13 pro...    20   10.0 
AF225975-1|AAF74117.1|  256|Tribolium castaneum unknown protein.       20   10.0 

>AY531877-1|AAT08872.1|  247|Tribolium castaneum ORF1p protein.
          Length = 247

 Score = 23.0 bits (47), Expect = 1.1
 Identities = 13/55 (23%), Positives = 23/55 (41%)
 Frame = +2

Query: 140 NKRSKIEQMFELQHLKTKFPSAQKAQGAPQSSGKSHDEPRRHQNQRQSEKSARGR 304
           ++R K  +  E    + K P A+   G  Q +  S   PR++   R     +R +
Sbjct: 162 SERMKTTRALEKTSEELKIPKAKINTGKTQYNLNSKSLPRQYSQSRGRHNQSRSK 216


>AM292372-1|CAL23184.2|  771|Tribolium castaneum gustatory receptor
           candidate 51 protein.
          Length = 771

 Score = 21.4 bits (43), Expect = 3.3
 Identities = 8/22 (36%), Positives = 13/22 (59%)
 Frame = -1

Query: 254 VRHEISQMTEELLALFEPRETW 189
           +RHE+ ++ +    L E  ETW
Sbjct: 608 MRHELQKLAQVYRILGETIETW 629


>EF592537-1|ABQ95983.1|  593|Tribolium castaneum
           beta-N-acetylglucosaminidase NAG2 protein.
          Length = 593

 Score = 20.6 bits (41), Expect = 5.7
 Identities = 9/17 (52%), Positives = 11/17 (64%)
 Frame = +3

Query: 219 ELLSHLGNLMTNQDGTK 269
           E LS L ++  N DGTK
Sbjct: 183 ETLSQLMDVYPNNDGTK 199



 Score = 20.2 bits (40), Expect = 7.5
 Identities = 8/26 (30%), Positives = 13/26 (50%)
 Frame = +3

Query: 285 RNRQEDDSSKVVWRYLELIHRCNTKN 362
           +N   D   ++ W +LE +   NT N
Sbjct: 101 KNEVNDFLREISWIFLETVANENTTN 126


>DQ659252-1|ABG47450.1|  377|Tribolium castaneum chitinase 13
           protein.
          Length = 377

 Score = 19.8 bits (39), Expect = 10.0
 Identities = 7/10 (70%), Positives = 8/10 (80%)
 Frame = +1

Query: 13  F*GHHFRISD 42
           F GHHF +SD
Sbjct: 257 FYGHHFILSD 266


>AF225975-1|AAF74117.1|  256|Tribolium castaneum unknown protein.
          Length = 256

 Score = 19.8 bits (39), Expect = 10.0
 Identities = 7/25 (28%), Positives = 14/25 (56%)
 Frame = +1

Query: 64  FGGPLSFRR*ALLDNRWENNRPSPG 138
           FG  L   +    +++W+++  SPG
Sbjct: 100 FGNNLHSEKAKFNESKWQDSGESPG 124


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 85,791
Number of Sequences: 336
Number of extensions: 1658
Number of successful extensions: 6
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 122,585
effective HSP length: 51
effective length of database: 105,449
effective search space used:  8225022
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 39 (20.8 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).