SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0002
         (720 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro...    28   0.066
AM292372-1|CAL23184.2|  771|Tribolium castaneum gustatory recept...    26   0.27 
DQ659253-1|ABG47451.1|  439|Tribolium castaneum imaginal disc gr...    24   1.4  
DQ659254-1|ABG47452.1|  431|Tribolium castaneum imaginal disc gr...    23   3.3  
AY873916-1|AAW67572.1|  377|Tribolium castaneum chitinase 6 prot...    22   5.8  
AM292354-1|CAL23166.1|  321|Tribolium castaneum gustatory recept...    22   5.8  

>DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10
           protein.
          Length = 2700

 Score = 28.3 bits (60), Expect = 0.066
 Identities = 9/21 (42%), Positives = 11/21 (52%)
 Frame = -1

Query: 222 RNNFSIRYWSWNYRGCWHQTC 160
           R+NF   +  WNY  CW   C
Sbjct: 746 RHNFKGLHLDWNYPVCWQSNC 766



 Score = 23.4 bits (48), Expect = 1.9
 Identities = 8/25 (32%), Positives = 9/25 (36%)
 Frame = -1

Query: 234  ELFNRNNFSIRYWSWNYRGCWHQTC 160
            +    NNF      W Y  CW   C
Sbjct: 1930 DFIETNNFDGLDLDWEYPKCWQVDC 1954


>AM292372-1|CAL23184.2|  771|Tribolium castaneum gustatory receptor
           candidate 51 protein.
          Length = 771

 Score = 26.2 bits (55), Expect = 0.27
 Identities = 9/27 (33%), Positives = 15/27 (55%)
 Frame = +1

Query: 484 LFCWFSELQVMINRDNWGHSYCDVRGE 564
           L+CW S L++ + +  W    CD+  E
Sbjct: 548 LYCWSSFLKISVLQSLWASPTCDLMYE 574


>DQ659253-1|ABG47451.1|  439|Tribolium castaneum imaginal disc
           growth factor 2 protein.
          Length = 439

 Score = 23.8 bits (49), Expect = 1.4
 Identities = 9/27 (33%), Positives = 14/27 (51%)
 Frame = +2

Query: 17  TSKEGSRRANYPLPAREVVTKNNDTGL 97
           T     + A+YP P  E+V + ND  +
Sbjct: 250 TPARNPKEADYPSPLYELVDRRNDENI 276


>DQ659254-1|ABG47452.1|  431|Tribolium castaneum imaginal disc
           growth factor 4 protein.
          Length = 431

 Score = 22.6 bits (46), Expect = 3.3
 Identities = 8/24 (33%), Positives = 13/24 (54%)
 Frame = +2

Query: 17  TSKEGSRRANYPLPAREVVTKNND 88
           T K   + A+YP P  E++ +  D
Sbjct: 242 TPKRNPKEADYPAPLYELIDRKYD 265


>AY873916-1|AAW67572.1|  377|Tribolium castaneum chitinase 6
           protein.
          Length = 377

 Score = 21.8 bits (44), Expect = 5.8
 Identities = 11/34 (32%), Positives = 13/34 (38%)
 Frame = -1

Query: 285 SITADAVHRQPAHKCNYELFNRNNFSIRYWSWNY 184
           ++ ADA  R    K   E F   NF      W Y
Sbjct: 111 AVAADATKRATMAKSALEFFETYNFDGLDVDWEY 144


>AM292354-1|CAL23166.1|  321|Tribolium castaneum gustatory receptor
           candidate 33 protein.
          Length = 321

 Score = 21.8 bits (44), Expect = 5.8
 Identities = 5/16 (31%), Positives = 9/16 (56%)
 Frame = -1

Query: 213 FSIRYWSWNYRGCWHQ 166
           +++ YW   Y   WH+
Sbjct: 117 YAVYYWRQQYEDFWHR 132


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 163,152
Number of Sequences: 336
Number of extensions: 3492
Number of successful extensions: 13
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 13
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 19155320
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).