SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0039
         (826 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U09586-3|AAC47272.1|  470|Tribolium castaneum integrase protein.       54   2e-09
DQ855494-1|ABH88181.1|   99|Tribolium castaneum chemosensory pro...    26   0.42 
EU008544-1|ABS31131.1|  493|Tribolium castaneum cytochrome P450 ...    23   2.9  
AM292372-1|CAL23184.2|  771|Tribolium castaneum gustatory recept...    23   2.9  
AY490815-1|AAR82970.1|  136|Tribolium castaneum glass protein pr...    22   6.8  
AY293621-1|AAP46162.1|  392|Tribolium castaneum glass protein pr...    22   6.8  
AM292361-1|CAL23173.2|  373|Tribolium castaneum gustatory recept...    21   9.0  
AF452568-1|AAL57830.1|  243|Tribolium castaneum homeodomain tran...    21   9.0  
AF321227-5|AAK16425.1|  292|Tribolium castaneum Zen2 protein.          21   9.0  

>U09586-3|AAC47272.1|  470|Tribolium castaneum integrase protein.
          Length = 470

 Score = 53.6 bits (123), Expect = 2e-09
 Identities = 33/105 (31%), Positives = 50/105 (47%)
 Frame = -1

Query: 817 PKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIVEN 638
           PK +++D G  F S   +   R   I+   +S  HP++    ER    L    R+Y  EN
Sbjct: 257 PKCVLSDHGTQFISNTWQNSLRAADIQPTLSSIRHPES-NPSERVMRELGRIFRAYCREN 315

Query: 637 QHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSL 503
             +W  +L       N   H +TGFSP E+L+G  P  P  +D++
Sbjct: 316 HASWVNHLSNIEDCLNYVPHISTGFSPYEILYGRTP--PNPLDAV 358


>DQ855494-1|ABH88181.1|   99|Tribolium castaneum chemosensory
           protein 8 protein.
          Length = 99

 Score = 25.8 bits (54), Expect = 0.42
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = +2

Query: 101 CNSRKPNEGRRRNRFVPSLLSDVWN 175
           C+SR+    RR  R+V +   DVWN
Sbjct: 67  CDSRQVANARRIARYVQTKHPDVWN 91


>EU008544-1|ABS31131.1|  493|Tribolium castaneum cytochrome P450
           protein.
          Length = 493

 Score = 23.0 bits (47), Expect = 2.9
 Identities = 10/24 (41%), Positives = 16/24 (66%)
 Frame = -1

Query: 634 HTWDLYLRTAMLAYNSNIHSTTGF 563
           HT ++ ++TAM  Y+ +I ST  F
Sbjct: 160 HTEEIDVKTAMKKYSVDIISTCAF 183


>AM292372-1|CAL23184.2|  771|Tribolium castaneum gustatory receptor
           candidate 51 protein.
          Length = 771

 Score = 23.0 bits (47), Expect = 2.9
 Identities = 8/27 (29%), Positives = 16/27 (59%)
 Frame = +2

Query: 659 KIFFQSRMTSF*GATSLRVIWRSKNVF 739
           K   ++ M++F   T +R +W+  N+F
Sbjct: 392 KTVLKTTMSTFSDITFMRTVWKFFNIF 418


>AY490815-1|AAR82970.1|  136|Tribolium castaneum glass protein
           protein.
          Length = 136

 Score = 21.8 bits (44), Expect = 6.8
 Identities = 15/53 (28%), Positives = 21/53 (39%)
 Frame = -1

Query: 736 HIFASPYHPQTCGALERSHSTLKEYLRSYIVENQHTWDLYLRTAMLAYNSNIH 578
           H    PY  + C       STL ++LR +  E  +   L L     + N N H
Sbjct: 72  HSGERPYRCRLCKKAFSDSSTLTKHLRIHSGEKPYECKLCLLRFSQSGNLNRH 124


>AY293621-1|AAP46162.1|  392|Tribolium castaneum glass protein
           protein.
          Length = 392

 Score = 21.8 bits (44), Expect = 6.8
 Identities = 15/53 (28%), Positives = 21/53 (39%)
 Frame = -1

Query: 736 HIFASPYHPQTCGALERSHSTLKEYLRSYIVENQHTWDLYLRTAMLAYNSNIH 578
           H    PY  + C       STL ++LR +  E  +   L L     + N N H
Sbjct: 328 HSGERPYRCRLCKKAFSDSSTLTKHLRIHSGEKPYECKLCLLRFSQSGNLNRH 380


>AM292361-1|CAL23173.2|  373|Tribolium castaneum gustatory receptor
           candidate 40 protein.
          Length = 373

 Score = 21.4 bits (43), Expect = 9.0
 Identities = 17/46 (36%), Positives = 22/46 (47%), Gaps = 9/46 (19%)
 Frame = +2

Query: 638 VFNYIRPKIFFQSRMTSF*-----GATS----LRVIWRSKNVFYSE 748
           +F Y+   I F   +T+F      G TS    L   W SK VFYS+
Sbjct: 190 IFTYMPYNIVFGLCLTTFGLLPVNGVTSEKCNLTFSWYSKKVFYSK 235


>AF452568-1|AAL57830.1|  243|Tribolium castaneum homeodomain
           transcription factor Zen2 protein.
          Length = 243

 Score = 21.4 bits (43), Expect = 9.0
 Identities = 8/17 (47%), Positives = 10/17 (58%)
 Frame = -3

Query: 323 APFFNRYHTQTQKLGLQ 273
           AP FN Y  + Q LG +
Sbjct: 14  APVFNNYMDENQALGFK 30


>AF321227-5|AAK16425.1|  292|Tribolium castaneum Zen2 protein.
          Length = 292

 Score = 21.4 bits (43), Expect = 9.0
 Identities = 8/17 (47%), Positives = 10/17 (58%)
 Frame = -3

Query: 323 APFFNRYHTQTQKLGLQ 273
           AP FN Y  + Q LG +
Sbjct: 34  APVFNNYMDENQALGFK 50


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 177,029
Number of Sequences: 336
Number of extensions: 3748
Number of successful extensions: 17
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 16
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 16
length of database: 122,585
effective HSP length: 56
effective length of database: 103,769
effective search space used: 22621642
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).