SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0037
         (740 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF227923-1|AAF36721.1|  351|Tribolium castaneum abdominal-B prot...    24   1.5  
AJ223614-1|CAA11490.1|  301|Tribolium castaneum orthodenticle-2 ...    23   2.6  
AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr...    23   3.4  
AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ...    22   6.0  
AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ...    22   6.0  
DQ211693-1|ABB16909.1|  314|Tribolium castaneum dorsocross protein.    21   7.9  
AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept...    21   7.9  

>AF227923-1|AAF36721.1|  351|Tribolium castaneum abdominal-B
           protein.
          Length = 351

 Score = 23.8 bits (49), Expect = 1.5
 Identities = 9/28 (32%), Positives = 16/28 (57%)
 Frame = +3

Query: 90  ESRRAVGWGPDC*SPGTGSARRWSAAVP 173
           +SR+ + W P   +  T +  ++SAA P
Sbjct: 101 DSRKGLFWSPAATAAATATEYKYSAAAP 128


>AJ223614-1|CAA11490.1|  301|Tribolium castaneum orthodenticle-2
           protein protein.
          Length = 301

 Score = 23.0 bits (47), Expect = 2.6
 Identities = 9/19 (47%), Positives = 14/19 (73%)
 Frame = -2

Query: 196 ATNSASPGGTAADHLRAEP 140
           +++++SP  TAA HLR  P
Sbjct: 168 SSSASSPSVTAAPHLRDSP 186


>AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like
           protein protein.
          Length = 1156

 Score = 22.6 bits (46), Expect = 3.4
 Identities = 13/37 (35%), Positives = 16/37 (43%)
 Frame = +3

Query: 132 PGTGSARRWSAAVPPGLAEFVAPLQRAGLCLLAHQPH 242
           P T  A   +A +PP  A   A L  A +   A Q H
Sbjct: 126 PPTLPAAAAAALLPPQTAAMAAYLNAAAVAAAAQQSH 162


>AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase
            protein.
          Length = 1464

 Score = 21.8 bits (44), Expect = 6.0
 Identities = 9/25 (36%), Positives = 14/25 (56%)
 Frame = -2

Query: 472  LEPQSFIKLVIGIVIYIRLHIMVLM 398
            L PQ F  L  G++ Y+ +  M L+
Sbjct: 994  LHPQEFNCLKYGVIYYVTVPSMYLL 1018


>AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2
            protein.
          Length = 1464

 Score = 21.8 bits (44), Expect = 6.0
 Identities = 9/25 (36%), Positives = 14/25 (56%)
 Frame = -2

Query: 472  LEPQSFIKLVIGIVIYIRLHIMVLM 398
            L PQ F  L  G++ Y+ +  M L+
Sbjct: 994  LHPQEFNCLKYGVIYYVTVPSMYLL 1018


>DQ211693-1|ABB16909.1|  314|Tribolium castaneum dorsocross protein.
          Length = 314

 Score = 21.4 bits (43), Expect = 7.9
 Identities = 6/13 (46%), Positives = 9/13 (69%)
 Frame = +3

Query: 81  CRYESRRAVGWGP 119
           CR++   +VGW P
Sbjct: 77  CRFKFSSSVGWSP 89


>AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor
            candidate 46 protein.
          Length = 1451

 Score = 21.4 bits (43), Expect = 7.9
 Identities = 9/27 (33%), Positives = 15/27 (55%)
 Frame = +1

Query: 652  CIPVCMYVSRMYIGMYVCLSYVYRYVC 732
            C   C + S++ I   V L+ VY ++C
Sbjct: 1111 CSNRCFFPSKIRICWNVLLNCVYLFLC 1137


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 168,524
Number of Sequences: 336
Number of extensions: 3757
Number of successful extensions: 11
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 11
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 19884055
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).