SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0036
         (830 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY600516-1|AAT11864.1|  143|Tribolium castaneum optomotor-blind-...    25   0.97 
AM292369-1|CAL23181.1|  408|Tribolium castaneum gustatory recept...    24   1.7  
AM292354-1|CAL23166.1|  321|Tribolium castaneum gustatory recept...    24   1.7  
AM292359-1|CAL23171.2|  436|Tribolium castaneum gustatory recept...    23   2.2  
AY337337-1|AAP94192.1|  505|Tribolium castaneum cytochrome P450 ...    22   5.2  
AM292382-1|CAL23194.2|  670|Tribolium castaneum gustatory recept...    22   5.2  
AF254755-1|AAF70496.1|  505|Tribolium castaneum cytochrome P450 ...    22   5.2  
AY043293-1|AAK96033.1|  523|Tribolium castaneum homeodomain tran...    22   6.9  
AF187069-1|AAF03889.1|  471|Tribolium castaneum proboscipedia or...    22   6.9  

>AY600516-1|AAT11864.1|  143|Tribolium castaneum
           optomotor-blind-like protein protein.
          Length = 143

 Score = 24.6 bits (51), Expect = 0.97
 Identities = 18/65 (27%), Positives = 28/65 (43%)
 Frame = -1

Query: 332 SLVSLKLENGWTDLANFGLELFVEVQRRFKSLKKYENARNYIKTNNFVFPLMSPPSDGFL 153
           S   LKL N  +D   F  E  V+      S+ KY+   + ++ N+    ++  P   F 
Sbjct: 73  SFHKLKLTNNISDKHGFLKEKAVDFLTILNSMHKYQPRFHLVRAND----ILKLPYSTFR 128

Query: 152 LYFFK 138
            Y FK
Sbjct: 129 TYVFK 133


>AM292369-1|CAL23181.1|  408|Tribolium castaneum gustatory receptor
           candidate 48 protein.
          Length = 408

 Score = 23.8 bits (49), Expect = 1.7
 Identities = 8/32 (25%), Positives = 17/32 (53%)
 Frame = +3

Query: 663 WSEIKRNDYIIKIR*KMFFSILTIMVPIFYVY 758
           + E +RNDY+  ++    F     +  ++Y+Y
Sbjct: 129 FKESERNDYVSLLQLVFVFCYFIYLFTVYYIY 160


>AM292354-1|CAL23166.1|  321|Tribolium castaneum gustatory receptor
           candidate 33 protein.
          Length = 321

 Score = 23.8 bits (49), Expect = 1.7
 Identities = 8/19 (42%), Positives = 15/19 (78%)
 Frame = -2

Query: 727 KIEKNIFYLILIM*SFLFI 671
           KI KN++YL+L + + L++
Sbjct: 94  KIRKNLYYLLLFVINVLYV 112


>AM292359-1|CAL23171.2|  436|Tribolium castaneum gustatory receptor
           candidate 38 protein.
          Length = 436

 Score = 23.4 bits (48), Expect = 2.2
 Identities = 15/53 (28%), Positives = 28/53 (52%), Gaps = 5/53 (9%)
 Frame = +3

Query: 651 IIGRWSEIKRNDY-IIKIR*KMFFS----ILTIMVPIFYVYVMYVGFLIIAYF 794
           ++  W   +R  Y + K +  +FF     ILT+++P+    VM V  + +A+F
Sbjct: 158 VVTDWVNFERIYYKLTKKKLSVFFGNKPVILTVVLPLLACGVMVVTHITMAHF 210


>AY337337-1|AAP94192.1|  505|Tribolium castaneum cytochrome P450
           monooxygenase protein.
          Length = 505

 Score = 22.2 bits (45), Expect = 5.2
 Identities = 5/17 (29%), Positives = 11/17 (64%)
 Frame = +2

Query: 767 CWVFNHCIFLTKDTHYI 817
           CW+ + CI++    +Y+
Sbjct: 224 CWLISKCIYVFNPRYYL 240


>AM292382-1|CAL23194.2|  670|Tribolium castaneum gustatory receptor
           candidate 61 protein.
          Length = 670

 Score = 22.2 bits (45), Expect = 5.2
 Identities = 10/27 (37%), Positives = 17/27 (62%), Gaps = 3/27 (11%)
 Frame = -2

Query: 166 RTDSFCIFLSLFYTKV---*VFYLSIE 95
           +T+ +C F+ LFY  V    V+Y S++
Sbjct: 317 KTNKYCNFIILFYLSVFVILVYYASLD 343


>AF254755-1|AAF70496.1|  505|Tribolium castaneum cytochrome P450
           monooxigenase CYP4Q7 protein.
          Length = 505

 Score = 22.2 bits (45), Expect = 5.2
 Identities = 5/17 (29%), Positives = 11/17 (64%)
 Frame = +2

Query: 767 CWVFNHCIFLTKDTHYI 817
           CW+ + CI++    +Y+
Sbjct: 224 CWLISKCIYVFNPRYYL 240


>AY043293-1|AAK96033.1|  523|Tribolium castaneum homeodomain
           transcription factor Maxillopediaprotein.
          Length = 523

 Score = 21.8 bits (44), Expect = 6.9
 Identities = 8/23 (34%), Positives = 14/23 (60%)
 Frame = -1

Query: 257 QRRFKSLKKYENARNYIKTNNFV 189
           Q+++   K + N+ NYI   N+V
Sbjct: 356 QQQYYYNKNHPNSENYINHQNYV 378


>AF187069-1|AAF03889.1|  471|Tribolium castaneum proboscipedia
           ortholog protein.
          Length = 471

 Score = 21.8 bits (44), Expect = 6.9
 Identities = 8/23 (34%), Positives = 14/23 (60%)
 Frame = -1

Query: 257 QRRFKSLKKYENARNYIKTNNFV 189
           Q+++   K + N+ NYI   N+V
Sbjct: 304 QQQYYYNKNHPNSENYINHQNYV 326


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 197,154
Number of Sequences: 336
Number of extensions: 4389
Number of successful extensions: 19
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 18
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 19
length of database: 122,585
effective HSP length: 56
effective length of database: 103,769
effective search space used: 22829180
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).