SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0035
         (754 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF227923-1|AAF36721.1|  351|Tribolium castaneum abdominal-B prot...    23   2.0  
EF592536-1|ABQ95982.1|  598|Tribolium castaneum beta-N-acetylglu...    22   4.6  
X97819-1|CAA66399.1|  251|Tribolium castaneum ZEN Tc protein.          22   6.0  
AM292381-1|CAL23193.2|  364|Tribolium castaneum gustatory recept...    22   6.0  
AJ223627-1|CAA11500.1|  371|Tribolium castaneum orthodenticle-1 ...    22   6.0  
AF321227-4|AAK16424.1|  246|Tribolium castaneum Zen protein.           22   6.0  

>AF227923-1|AAF36721.1|  351|Tribolium castaneum abdominal-B
           protein.
          Length = 351

 Score = 23.4 bits (48), Expect = 2.0
 Identities = 7/22 (31%), Positives = 13/22 (59%)
 Frame = -3

Query: 620 FDQHAPVRRVRIKHKPAPWLTP 555
           +  ++   R  + H+P P+LTP
Sbjct: 150 YSAYSSASRHHVDHQPVPYLTP 171


>EF592536-1|ABQ95982.1|  598|Tribolium castaneum
           beta-N-acetylglucosaminidase NAG1 protein.
          Length = 598

 Score = 22.2 bits (45), Expect = 4.6
 Identities = 20/79 (25%), Positives = 36/79 (45%)
 Frame = -3

Query: 245 LLKISSLSVPRIPIFELSPVSVADVRNSFFSISSTAVGIDNVCSKMIALILPTVAPILTD 66
           LL  + +S+   P ++   +++   RN F ++      +D     M A  L +    +TD
Sbjct: 194 LLMPNDVSITDEPAYQYRGIALDTSRN-FVTVDVIKRTLDG----MAASKLNSFHWHITD 248

Query: 65  IFNFSFTSSNFPDSWKPAA 9
             +F FT+ + PD  K  A
Sbjct: 249 SHSFPFTAESLPDLTKYGA 267


>X97819-1|CAA66399.1|  251|Tribolium castaneum ZEN Tc protein.
          Length = 251

 Score = 21.8 bits (44), Expect = 6.0
 Identities = 11/25 (44%), Positives = 13/25 (52%)
 Frame = +2

Query: 665 YYGVQEYTTSRYYLHPVATLPDQYP 739
           Y  +QE TT  YY +  A  P  YP
Sbjct: 24  YNFLQEKTTYEYYENNQALPPITYP 48


>AM292381-1|CAL23193.2|  364|Tribolium castaneum gustatory receptor
           candidate 60 protein.
          Length = 364

 Score = 21.8 bits (44), Expect = 6.0
 Identities = 9/34 (26%), Positives = 18/34 (52%), Gaps = 3/34 (8%)
 Frame = -3

Query: 455 RCNRLCRDAKR---LYFHKSLENRSPAHTWRFLK 363
           RC +LC++A +   L++H  ++         F+K
Sbjct: 156 RCTKLCKEANKTAFLWYHIKIDREDEEARDDFIK 189


>AJ223627-1|CAA11500.1|  371|Tribolium castaneum orthodenticle-1
           protein protein.
          Length = 371

 Score = 21.8 bits (44), Expect = 6.0
 Identities = 10/28 (35%), Positives = 12/28 (42%)
 Frame = +3

Query: 501 TFVSSFGFVPASHQSFNIRR*PRCRFMF 584
           T  S+ G     HQ+F  R  P C   F
Sbjct: 340 TGYSAMGMAAPHHQNFGPRHPPDCSMEF 367


>AF321227-4|AAK16424.1|  246|Tribolium castaneum Zen protein.
          Length = 246

 Score = 21.8 bits (44), Expect = 6.0
 Identities = 11/25 (44%), Positives = 13/25 (52%)
 Frame = +2

Query: 665 YYGVQEYTTSRYYLHPVATLPDQYP 739
           Y  +QE TT  YY +  A  P  YP
Sbjct: 15  YNFLQEKTTYEYYENNQALPPITYP 39


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 172,556
Number of Sequences: 336
Number of extensions: 3807
Number of successful extensions: 10
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 10
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 10
length of database: 122,585
effective HSP length: 56
effective length of database: 103,769
effective search space used: 20131186
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).