SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0034
         (840 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY600514-1|AAT11862.1|  242|Tribolium castaneum iroquois-like pr...    24   1.7  
EU019709-1|ABU25221.1|  540|Tribolium castaneum aspartate 1-deca...    23   3.0  
EF222292-1|ABN79652.1|  354|Tribolium castaneum cardioactive pep...    22   7.0  
DQ490059-1|ABF22614.1|  947|Tribolium castaneum short gastrulati...    22   7.0  
EF222294-1|ABN79654.1|  451|Tribolium castaneum ecdysis triggeri...    21   9.2  

>AY600514-1|AAT11862.1|  242|Tribolium castaneum iroquois-like
           protein protein.
          Length = 242

 Score = 23.8 bits (49), Expect = 1.7
 Identities = 11/19 (57%), Positives = 12/19 (63%)
 Frame = -1

Query: 807 YGAGYELPADLKTQTAFST 751
           YGAGY+L A  K  T  ST
Sbjct: 78  YGAGYDLAARRKNATREST 96


>EU019709-1|ABU25221.1|  540|Tribolium castaneum aspartate
           1-decarboxylase protein.
          Length = 540

 Score = 23.0 bits (47), Expect = 3.0
 Identities = 12/40 (30%), Positives = 21/40 (52%)
 Frame = -1

Query: 276 VDSYGDRKTWGSNGSSEKRHTWSLYPVKVGDQQLFLIENR 157
           VD YG    W ++  +   +T+ + PV V  +++ L E R
Sbjct: 142 VDPYGLVAQWATDALNPSVYTYEVSPVFVLMEEVVLREMR 181


>EF222292-1|ABN79652.1|  354|Tribolium castaneum cardioactive
           peptide receptor 2 protein.
          Length = 354

 Score = 21.8 bits (44), Expect = 7.0
 Identities = 11/45 (24%), Positives = 22/45 (48%), Gaps = 6/45 (13%)
 Frame = -1

Query: 381 SHHVSWQLISLWEDNNVIFKILN------TEYEMYLKLDVNVDSY 265
           S  ++W++   W   NV+ KI+       T    Y+ + +++D Y
Sbjct: 101 STDIAWRITVAWYAGNVLCKIIRFLQAVVTYSSTYVLVALSIDRY 145


>DQ490059-1|ABF22614.1|  947|Tribolium castaneum short gastrulation
           protein.
          Length = 947

 Score = 21.8 bits (44), Expect = 7.0
 Identities = 10/31 (32%), Positives = 17/31 (54%)
 Frame = +1

Query: 166 DEEQLLVSHLYRV*RPGVSLLTGTIRSPGLP 258
           DE++ ++  + RV +P   L    +RSP  P
Sbjct: 336 DEKKYILQEVVRVKKPHYELNMVEVRSPVTP 366


>EF222294-1|ABN79654.1|  451|Tribolium castaneum ecdysis triggering
           hormone receptorisoform B protein.
          Length = 451

 Score = 21.4 bits (43), Expect = 9.2
 Identities = 8/29 (27%), Positives = 15/29 (51%)
 Frame = +2

Query: 344 SQREMSCQLTWWLV*SFPSPQVRRSLYSP 430
           ++  + C L W++   F SP +  + Y P
Sbjct: 185 TRASLICLLAWFIAALFTSPILAITQYGP 213


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 179,961
Number of Sequences: 336
Number of extensions: 3838
Number of successful extensions: 7
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 122,585
effective HSP length: 56
effective length of database: 103,769
effective search space used: 23140487
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).