SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0033
         (887 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY873915-1|AAW67571.2|  384|Tribolium castaneum chitinase 16 pro...    25   1.0  
AY873914-1|AAW67570.1|  384|Tribolium castaneum chitinase 3 prot...    25   1.0  
AF322227-1|AAK01654.1|  782|Tribolium castaneum cell surface pro...    24   1.8  
AM292382-1|CAL23194.2|  670|Tribolium castaneum gustatory recept...    23   2.4  
EF592537-1|ABQ95983.1|  593|Tribolium castaneum beta-N-acetylglu...    23   3.2  
DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro...    23   4.2  
DQ414246-1|ABD63008.1|  126|Tribolium castaneum odd-skipped prot...    23   4.2  
AY008296-1|AAG22858.1|  556|Tribolium castaneum Dorsal protein.        22   7.4  
AJ005422-1|CAA06528.1|  287|Tribolium castaneum caudal protein p...    21   9.8  
AJ005421-1|CAA06527.1|  249|Tribolium castaneum caudal protein p...    21   9.8  

>AY873915-1|AAW67571.2|  384|Tribolium castaneum chitinase 16
           protein.
          Length = 384

 Score = 24.6 bits (51), Expect = 1.0
 Identities = 12/39 (30%), Positives = 20/39 (51%)
 Frame = +3

Query: 612 GIDVWEHAYYLQYKNVRADYVKAIFDVANWNDISQRYEK 728
           G++   H   L+ KN     VK +  +  WN+ SQ+Y +
Sbjct: 77  GLEELAHLMSLKEKNPN---VKILLSMGGWNEGSQKYSQ 112


>AY873914-1|AAW67570.1|  384|Tribolium castaneum chitinase 3
           protein.
          Length = 384

 Score = 24.6 bits (51), Expect = 1.0
 Identities = 12/39 (30%), Positives = 20/39 (51%)
 Frame = +3

Query: 612 GIDVWEHAYYLQYKNVRADYVKAIFDVANWNDISQRYEK 728
           G++   H   L+ KN     VK +  +  WN+ SQ+Y +
Sbjct: 77  GLEELAHLMSLKEKNPN---VKILLSMGGWNEGSQKYSQ 112


>AF322227-1|AAK01654.1|  782|Tribolium castaneum cell surface
           protein chaoptin protein.
          Length = 782

 Score = 23.8 bits (49), Expect = 1.8
 Identities = 16/42 (38%), Positives = 24/42 (57%)
 Frame = -1

Query: 677 FHVVGTNVLVLKIVRVLPYIDSEERDQSSGGLQRILVLACSY 552
           FHV  ++  ++ +V V P +  E+ D   GGLQ I VL  S+
Sbjct: 193 FHVNMSHNKLINLV-VAPSVPFEQ-DTGLGGLQNIKVLDLSF 232


>AM292382-1|CAL23194.2|  670|Tribolium castaneum gustatory receptor
           candidate 61 protein.
          Length = 670

 Score = 23.4 bits (48), Expect = 2.4
 Identities = 9/26 (34%), Positives = 15/26 (57%)
 Frame = +3

Query: 210 IMSLHHSKHHATYINNLNVAEEKLAQ 287
           I+S  H K    ++NN+   +E LA+
Sbjct: 99  IISFMHKKSFKNFVNNVAALDETLAK 124


>EF592537-1|ABQ95983.1|  593|Tribolium castaneum
           beta-N-acetylglucosaminidase NAG2 protein.
          Length = 593

 Score = 23.0 bits (47), Expect = 3.2
 Identities = 8/19 (42%), Positives = 14/19 (73%)
 Frame = -3

Query: 480 STVDSLCYPRIQSLSQRLW 424
           S+V+S  +PR  + ++RLW
Sbjct: 531 SSVESRVWPRAAAAAERLW 549


>DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein.
          Length = 2700

 Score = 22.6 bits (46), Expect = 4.2
 Identities = 11/30 (36%), Positives = 16/30 (53%)
 Frame = +1

Query: 583  RPPLDWSRSSESMYGSTRTIFSTRTFVPTT 672
            +P   WS ++ S + +T T   T T  PTT
Sbjct: 1038 KPSTWWSSTTTSPWWTTTTTRRTTTTRPTT 1067


>DQ414246-1|ABD63008.1|  126|Tribolium castaneum odd-skipped
           protein.
          Length = 126

 Score = 22.6 bits (46), Expect = 4.2
 Identities = 16/55 (29%), Positives = 22/55 (40%)
 Frame = +3

Query: 522 GYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVRADYVKAIF 686
           G+ +Q+K+   +T     P        P    D W + YY QY    A Y K  F
Sbjct: 3   GFVRQVKQEADSTSPLLTPPHNPAYSPPPSYCDPWYNPYYYQYLQNAALYHKLQF 57


>AY008296-1|AAG22858.1|  556|Tribolium castaneum Dorsal protein.
          Length = 556

 Score = 21.8 bits (44), Expect = 7.4
 Identities = 12/47 (25%), Positives = 21/47 (44%)
 Frame = +3

Query: 234 HHATYINNLNVAEEKLAQAQAKGDIDTIINLAPALKFNGGGHINHSI 374
           H    + N  + +E +  +     I+T  +   +  FNGGG I  +I
Sbjct: 5   HLEQTLENAGMPDESINISDVIEVIETDPDFHESTMFNGGGEIPQNI 51


>AJ005422-1|CAA06528.1|  287|Tribolium castaneum caudal protein
           protein.
          Length = 287

 Score = 21.4 bits (43), Expect = 9.8
 Identities = 8/16 (50%), Positives = 10/16 (62%)
 Frame = -2

Query: 520 SQPQPEPCTATEAVDS 473
           SQP PEP    +A D+
Sbjct: 134 SQPNPEPADFADAPDA 149


>AJ005421-1|CAA06527.1|  249|Tribolium castaneum caudal protein
           protein.
          Length = 249

 Score = 21.4 bits (43), Expect = 9.8
 Identities = 8/16 (50%), Positives = 10/16 (62%)
 Frame = -2

Query: 520 SQPQPEPCTATEAVDS 473
           SQP PEP    +A D+
Sbjct: 134 SQPNPEPADFADAPDA 149


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 204,513
Number of Sequences: 336
Number of extensions: 4609
Number of successful extensions: 20
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 20
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 20
length of database: 122,585
effective HSP length: 57
effective length of database: 103,433
effective search space used: 24617054
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).