SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0031
         (644 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292339-1|CAL23151.2|  387|Tribolium castaneum gustatory recept...    25   0.53 
AM292338-1|CAL23150.2|  372|Tribolium castaneum gustatory recept...    25   0.53 
AM292340-1|CAL23152.1|  355|Tribolium castaneum gustatory recept...    24   1.2  
EF222295-1|ABN79655.1|  146|Tribolium castaneum arginine vasopre...    22   3.8  
DQ855491-1|ABH88178.1|  144|Tribolium castaneum chemosensory pro...    22   3.8  
AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ...    21   6.6  
AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ...    21   6.6  
S78567-1|AAB34900.1|  141|Tribolium castaneum GABA receptor subu...    21   8.7  
AM292337-1|CAL23149.2|  452|Tribolium castaneum gustatory recept...    21   8.7  
AF264721-1|AAF75273.1|  126|Tribolium castaneum putative cytochr...    21   8.7  

>AM292339-1|CAL23151.2|  387|Tribolium castaneum gustatory receptor
           candidate 18 protein.
          Length = 387

 Score = 25.0 bits (52), Expect = 0.53
 Identities = 10/31 (32%), Positives = 17/31 (54%)
 Frame = +3

Query: 534 LHMNSIKLFKQVRDCFVFTSLFWLSVITAVI 626
           +H N +   ++V D F    L W+S+I  V+
Sbjct: 223 MHSNLVTTSEEVCDSFSIFGLVWISLIFVVL 253


>AM292338-1|CAL23150.2|  372|Tribolium castaneum gustatory receptor
           candidate 17 protein.
          Length = 372

 Score = 25.0 bits (52), Expect = 0.53
 Identities = 10/31 (32%), Positives = 17/31 (54%)
 Frame = +3

Query: 534 LHMNSIKLFKQVRDCFVFTSLFWLSVITAVI 626
           +H N +   ++V D F    L W+S+I  V+
Sbjct: 223 MHSNLVTTSEEVCDSFSIFGLVWISLIFVVL 253


>AM292340-1|CAL23152.1|  355|Tribolium castaneum gustatory receptor
           candidate 19 protein.
          Length = 355

 Score = 23.8 bits (49), Expect = 1.2
 Identities = 8/19 (42%), Positives = 13/19 (68%)
 Frame = +3

Query: 477 VYYFMVFFLLLIGI*YYFC 533
           +YYF+V    L+ I Y++C
Sbjct: 133 IYYFVVPLFFLLCIYYFYC 151



 Score = 21.4 bits (43), Expect = 6.6
 Identities = 8/19 (42%), Positives = 13/19 (68%)
 Frame = +3

Query: 486 FMVFFLLLIGI*YYFCLHM 542
           F V  LLL+ I Y++ +H+
Sbjct: 248 FTVHLLLLVCIYYFYYMHL 266


>EF222295-1|ABN79655.1|  146|Tribolium castaneum arginine
           vasopressin-like peptide protein.
          Length = 146

 Score = 22.2 bits (45), Expect = 3.8
 Identities = 8/23 (34%), Positives = 10/23 (43%)
 Frame = -2

Query: 331 LIERPHCCRCGWNDIVHEEEKCV 263
           L+  P   RC      HE E C+
Sbjct: 69  LVGTPETLRCQREGFFHEREPCI 91


>DQ855491-1|ABH88178.1|  144|Tribolium castaneum chemosensory
           protein 5 protein.
          Length = 144

 Score = 22.2 bits (45), Expect = 3.8
 Identities = 7/10 (70%), Positives = 10/10 (100%)
 Frame = +2

Query: 479 VLFYGIFFII 508
           +LF+G+FFII
Sbjct: 6   ILFFGVFFII 15


>AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase
            variant 2 protein.
          Length = 1558

 Score = 21.4 bits (43), Expect = 6.6
 Identities = 11/37 (29%), Positives = 18/37 (48%)
 Frame = +2

Query: 185  KYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNVI 295
            KYL P D    +   + ++ I LR +    FF+ N +
Sbjct: 1242 KYLYPIDENKEEKARIAKELIELRNKSVFAFFMFNAL 1278


>AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B
            protein.
          Length = 1558

 Score = 21.4 bits (43), Expect = 6.6
 Identities = 11/37 (29%), Positives = 18/37 (48%)
 Frame = +2

Query: 185  KYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNVI 295
            KYL P D    +   + ++ I LR +    FF+ N +
Sbjct: 1242 KYLYPIDENKEEKARIAKELIELRNKSVFAFFMFNAL 1278


>S78567-1|AAB34900.1|  141|Tribolium castaneum GABA receptor subunit
           protein.
          Length = 141

 Score = 21.0 bits (42), Expect = 8.7
 Identities = 6/11 (54%), Positives = 10/11 (90%)
 Frame = -2

Query: 391 SIDIFVGKCYV 359
           SID+++G C+V
Sbjct: 129 SIDVYLGTCFV 139


>AM292337-1|CAL23149.2|  452|Tribolium castaneum gustatory receptor
           candidate 16 protein.
          Length = 452

 Score = 21.0 bits (42), Expect = 8.7
 Identities = 8/26 (30%), Positives = 13/26 (50%)
 Frame = +3

Query: 534 LHMNSIKLFKQVRDCFVFTSLFWLSV 611
           LH N +K+ K     +    L W++V
Sbjct: 236 LHKNLVKVAKDHNSLYSLHLLLWITV 261


>AF264721-1|AAF75273.1|  126|Tribolium castaneum putative cytochrome
           P450 monooxigenaseCYP4Q2 protein.
          Length = 126

 Score = 21.0 bits (42), Expect = 8.7
 Identities = 7/22 (31%), Positives = 13/22 (59%)
 Frame = +2

Query: 290 VIPPTSATMGSLYQEHHDEDFF 355
           +IP  + T+  +Y  HH+ D +
Sbjct: 80  LIPKDTITIIHIYDLHHNPDIY 101


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 152,272
Number of Sequences: 336
Number of extensions: 3471
Number of successful extensions: 14
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 11
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 14
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 16552695
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).