SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0028
         (956 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM295015-1|CAL25730.1|  549|Tribolium castaneum ecdysone recepto...    26   0.38 
DQ490059-1|ABF22614.1|  947|Tribolium castaneum short gastrulati...    23   2.7  
AY695256-1|AAW21973.1|  168|Tribolium castaneum ventral nerve co...    23   2.7  
AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr...    23   4.6  
AM292372-1|CAL23184.2|  771|Tribolium castaneum gustatory recept...    22   8.1  

>AM295015-1|CAL25730.1|  549|Tribolium castaneum ecdysone receptor
           (isoform A) protein.
          Length = 549

 Score = 26.2 bits (55), Expect = 0.38
 Identities = 13/39 (33%), Positives = 18/39 (46%)
 Frame = -2

Query: 625 VSTAGPSSSPRDGLSCCSETRQDSWHPLHRGQCPRYSTS 509
           +S++GP SS   G+S     R D W     G  P  + S
Sbjct: 82  LSSSGPFSSIGGGISASKRQRTDDWLSSPSGNVPPLTPS 120


>DQ490059-1|ABF22614.1|  947|Tribolium castaneum short gastrulation
           protein.
          Length = 947

 Score = 23.4 bits (48), Expect = 2.7
 Identities = 10/28 (35%), Positives = 12/28 (42%)
 Frame = +1

Query: 202 PAATVTPSNHWPGHCCCAWPSLRYVADL 285
           P  T     H PG CC   P   Y +D+
Sbjct: 90  PEPTCDEPVHRPGRCCKTCPGDLYDSDI 117


>AY695256-1|AAW21973.1|  168|Tribolium castaneum ventral nerve cord
           defective protein protein.
          Length = 168

 Score = 23.4 bits (48), Expect = 2.7
 Identities = 13/32 (40%), Positives = 16/32 (50%)
 Frame = +3

Query: 750 VRVLLRDIGGKACWDASALYFDPSGGQLEGGP 845
           V VL+RD  GK C      + DP   Q+ G P
Sbjct: 121 VPVLVRD--GKPCLSGGPKHPDPGSLQVPGAP 150


>AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein
            protein.
          Length = 1156

 Score = 22.6 bits (46), Expect = 4.6
 Identities = 10/27 (37%), Positives = 14/27 (51%)
 Frame = +3

Query: 648  RFSDSTLASLIELPALDLPARAGTTPG 728
            R   +T  S +     ++P  AGTTPG
Sbjct: 1008 RTHSATSNSSVNANTNNIPTNAGTTPG 1034


>AM292372-1|CAL23184.2|  771|Tribolium castaneum gustatory receptor
           candidate 51 protein.
          Length = 771

 Score = 21.8 bits (44), Expect = 8.1
 Identities = 8/21 (38%), Positives = 15/21 (71%)
 Frame = +2

Query: 863 IVSRITIHWPSFYNVVTWKTL 925
           I++ +TI   +F++V  W+TL
Sbjct: 92  ILTTVTIFKSAFWDVDKWRTL 112


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 216,887
Number of Sequences: 336
Number of extensions: 4710
Number of successful extensions: 7
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 122,585
effective HSP length: 57
effective length of database: 103,433
effective search space used: 26996013
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).