SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0026
         (744 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U09586-2|AAC47271.1|  712|Tribolium castaneum protease, reverse ...    23   2.0  
EF125543-1|ABL73927.1|  475|Tribolium castaneum chitinase 4 prot...    23   2.0  
DQ342040-1|ABC69932.1|  822|Tribolium castaneum STIP protein.          22   4.5  
AY884064-1|AAX84205.1|  683|Tribolium castaneum pro-phenol oxida...    22   4.5  
AY884062-1|AAX84203.1|  712|Tribolium castaneum laccase 2B protein.    22   6.0  
AY884061-1|AAX84202.1|  717|Tribolium castaneum laccase 2A protein.    22   6.0  

>U09586-2|AAC47271.1|  712|Tribolium castaneum protease, reverse
           transcriptase andRNase H protein.
          Length = 712

 Score = 23.4 bits (48), Expect = 2.0
 Identities = 12/41 (29%), Positives = 21/41 (51%), Gaps = 1/41 (2%)
 Frame = +3

Query: 504 LTSLLYTCCRSPPICIEMMRRWSSSLH-HTRNVLFSLW*MP 623
           + S +   C SPP   E++RR+    +  T ++  S W +P
Sbjct: 364 INSKMIADCESPPAADELLRRFHEIRYMSTIDLRSSYWQIP 404


>EF125543-1|ABL73927.1|  475|Tribolium castaneum chitinase 4
           protein.
          Length = 475

 Score = 23.4 bits (48), Expect = 2.0
 Identities = 11/40 (27%), Positives = 21/40 (52%)
 Frame = -3

Query: 592 LVWCNEEDHLRIISMQMGGDLQQVYKRLVSAVNEIEKKIP 473
           ++W  E D  R +S      L+ +++ L  + NEI + +P
Sbjct: 355 MIWSIETDDFRGVSGTKYPILKAIHQTLGGSSNEIVEPVP 394


>DQ342040-1|ABC69932.1|  822|Tribolium castaneum STIP protein.
          Length = 822

 Score = 22.2 bits (45), Expect = 4.5
 Identities = 8/18 (44%), Positives = 14/18 (77%)
 Frame = -2

Query: 530 AAGVQEAGERRQRDREED 477
           A GVQ+AG++ +  ++ED
Sbjct: 67  AGGVQQAGKKPENVKKED 84


>AY884064-1|AAX84205.1|  683|Tribolium castaneum pro-phenol oxidase
           subunit 2 protein.
          Length = 683

 Score = 22.2 bits (45), Expect = 4.5
 Identities = 9/30 (30%), Positives = 15/30 (50%)
 Frame = -3

Query: 622 GIYHNENKTFLVWCNEEDHLRIISMQMGGD 533
           G  HN    F+ + ++ DH  + S  + GD
Sbjct: 360 GDLHNMGHVFISYIHDPDHRHLESFGVMGD 389


>AY884062-1|AAX84203.1|  712|Tribolium castaneum laccase 2B protein.
          Length = 712

 Score = 21.8 bits (44), Expect = 6.0
 Identities = 8/20 (40%), Positives = 12/20 (60%)
 Frame = -3

Query: 466 HHDRLGFLTFCPTNLGTTVR 407
           ++D + F+T CP   G T R
Sbjct: 211 YYDGVPFVTQCPIQQGNTFR 230


>AY884061-1|AAX84202.1|  717|Tribolium castaneum laccase 2A protein.
          Length = 717

 Score = 21.8 bits (44), Expect = 6.0
 Identities = 8/20 (40%), Positives = 12/20 (60%)
 Frame = -3

Query: 466 HHDRLGFLTFCPTNLGTTVR 407
           ++D + F+T CP   G T R
Sbjct: 211 YYDGVPFVTQCPIQQGNTFR 230


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 114,266
Number of Sequences: 336
Number of extensions: 2073
Number of successful extensions: 6
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 122,585
effective HSP length: 56
effective length of database: 103,769
effective search space used: 19819879
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).